KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023237Help
Entry
IscW_ISCW023237   CDS       T01131                                 

Definition
alpha-amylase, putative (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IscW_ISCW023237
Enzymes [BR:isc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     IscW_ISCW023237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 352 aa AA seqDB search
MLWTVFATLVAVVVVLLPRGDSAISGSFDNPGFKEDRTTIVEMFEWTWADVARECVDFLG
PHGYGAVQVSPPSENAVQLYTTPGGDKVRSWYERYEPVSYQISSPSGDLNDFEEMVRECE
KANVRKTKGSELRDLKQDVLHWSSRDVLYVDNHETQRGVDVSDPKQDVVSYQDRRNHVLA
NILMLAMPQGIPRVMSSYALNVDVQPYVPPKKLGPPSDHAFNTRPVLMKEDYTCYNGWIC
EHRWLPIRNMVKFRNVVASAPVTNWWDDSEDAVAFARLRKGFVLINNGRSTVTGLFNTTL
PQGYYCDVLSGSSVDRRSCTGNVVRVREDGFAELAVEGVGDVPAVAIQADVS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggacggtgtttgccacgctggtggctgtggtggtggtgttgttgccacgaggt
gactcggcaatatcggggtcgttcgacaaccccgggtttaaggaggaccgaaccacgata
gttgagatgtttgagtggacatgggccgatgtggcgcgagagtgcgtggacttcctcgga
cctcacggatacggcgcagttcaggtgtcgccacccagcgaaaacgcggttcagctgtac
acgactcccggcggggacaaggtgcggtcctggtacgagcgctacgagccggtcagctac
cagatctcctctcccagcggagatctcaatgacttcgaggaaatggtgcgcgagtgcgaa
aaagcgaacgttcggaagaccaagggatctgagctgagggacctcaagcaagacgtgttg
cactggtcttcgagagacgtactgtacgtcgacaaccacgaaacccagcgtggagtggac
gtttcggacccgaagcaggacgtcgtctcgtaccaggaccggagaaaccacgtcctggcc
aacatcctgatgctggccatgccgcagggcattccccgagtcatgagcagctacgctttg
aacgtagacgttcagccctacgttcctccgaagaagctgggcccgccttcggaccacgcc
ttcaacacccgtcccgtgctcatgaaggaggactacacctgctacaatggatggatatgt
gaacacaggtggctacccatacgaaacatggtcaagttccgcaatgttgtcgcttcggcg
cctgtcaccaactggtgggacgacagcgaggacgccgtagcgttcgccaggctccgcaag
ggcttcgtgttgatcaacaacggccgctccacggtcacgggactgttcaacaccaccctg
cctcagggctactactgcgacgtcctcagcggcagttcggtggaccgcagatcctgcacg
ggcaacgtggttcgggtcagggaggacggtttcgccgagctggccgttgaaggcgtcgga
gacgtgcctgccgtcgccattcaagccgacgtgagttga

DBGET integrated database retrieval system