KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023394Help
Entry
IscW_ISCW023394   CDS       T01131                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3, putative (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
isc  Ixodes scapularis (black-legged tick)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 111 aa AA seqDB search
MPPEWSFVDVFGLEPELLSMVPTPVAAVLLLFPYNQSYVDYVEEKSKEIEESGQVVSDRV
YFMKQTIMNACGAVALIHSLANCRDLIQLHGRKPFPINCGPTTDETFLLVS
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggagtggtccttcgtggatgtctttggccttgaacccgagctcctgagcatg
gtgccgactccggtcgcagccgtgctcctgctgttcccctacaaccagtcgtacgtggac
tacgtcgaggagaagagcaaggagattgaggagtctggtcaggtggtgagcgaccgtgtc
tacttcatgaagcagacgatcatgaacgcctgcggtgccgtggccctcatccactcgctc
gcaaactgccgcgacctcatccaactgcatgggcgcaagccgttccccatcaactgtggc
cccacaaccgacgagaccttcctgctggtgagttga

DBGET integrated database retrieval system