KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023655Help
Entry
IscW_ISCW023655   CDS       T01131                                 

Definition
mitogen-activated protein kinase, putative (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    IscW_ISCW023655
   04068 FoxO signaling pathway
    IscW_ISCW023655
   04150 mTOR signaling pathway
    IscW_ISCW023655
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    IscW_ISCW023655
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     IscW_ISCW023655
Protein kinases [BR:isc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   IscW_ISCW023655
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   IscW_ISCW023655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 384 aa AA seqDB search
LCEASARGMLEELARALVTKMATKEVESKATETVRGQLFEVAPRYTNLAYIGEGAYGMVV
SAFDNVTKEKVAIKKISPFEHQTYCQRTLREIKILTRFKHENIIDIRDIIRAPTIDQMKD
VYIVQCLMETDLYKLLKTQKLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT
CDLKICDFGLARVADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAE
MVSNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINEKARSYLQSLPHKAKIPWTKLYP
DADPKGRRGHQTILPMVFHCKGSCRRDTASDELHCLCTLQPMAEEPFKFETELDDLPKER
LKELVFEETNLFRSRCPTRPAQQS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttatgcgaggcttccgcgcgaggcatgctggaggagctcgcgagagcattggtaacgaaa
atggcgaccaaagaggttgaatcgaaagcaacggaaacagtcaggggccaactgttcgag
gttgcaccgcggtacacgaatttagcttacatcggagaaggtgcatacggcatggtcgtg
tcggccttcgacaatgtgaccaaggaaaaagtggccatcaagaagatctccccgttcgag
caccagacctactgccagaggacactgagggagatcaagatcctcacacggtttaagcac
gaaaatattatagacatcagagacatcatcagggcacccacaatcgaccagatgaaagat
gtctacattgtgcagtgcctgatggagactgacctgtacaagctgctcaagactcagaag
ctgagcaacgaccacatctgctacttcctctaccagatcctgaggggcctcaaatacatt
cattcggccaatgtgctgcacagggatctcaagcctagcaacctgctcctcaacaccact
tgtgacctcaagatctgcgactttggcctggcgcgggtggcggaccccgagcacgaccac
acgggcttcctgacggagtatgtggcgacgcggtggtaccgggcgccagagatcatgctg
aacagcaagggttacaccaagtctattgacatctggtctgtgggctgtatcctggcggag
atggtgtccaaccggcccatctttccgggcaagcactacctggaccagctgaaccacatc
ctgggcatcctaggctccccgtctcaggacgacctcaactgcatcatcaacgagaaggcc
cgctcctacctgcagtccctgccccacaaggccaagattccctggaccaagctgtacccg
gatgcagaccccaagggtaggcggggacatcaaaccattcttcccatggtatttcactgt
aaagggtcttgcagacgagacacggcatctgatgagctgcattgtttgtgcaccctgcag
ccgatggcggaagagccgttcaagtttgagacagagctggacgacctgcccaaggagcga
ctcaaggagctggtctttgaggagaccaacctgttccggtccaggtgccccaccaggccg
gcacagcagtcgtga

DBGET integrated database retrieval system