KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023655Help
Entry
IscW_ISCW023655   CDS       T01131                                 

Definition
mitogen-activated protein kinase, putative (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:isc04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:isc04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:isc04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:isc04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 384 aa AA seqDB search
LCEASARGMLEELARALVTKMATKEVESKATETVRGQLFEVAPRYTNLAYIGEGAYGMVV
SAFDNVTKEKVAIKKISPFEHQTYCQRTLREIKILTRFKHENIIDIRDIIRAPTIDQMKD
VYIVQCLMETDLYKLLKTQKLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT
CDLKICDFGLARVADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAE
MVSNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINEKARSYLQSLPHKAKIPWTKLYP
DADPKGRRGHQTILPMVFHCKGSCRRDTASDELHCLCTLQPMAEEPFKFETELDDLPKER
LKELVFEETNLFRSRCPTRPAQQS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttatgcgaggcttccgcgcgaggcatgctggaggagctcgcgagagcattggtaacgaaa
atggcgaccaaagaggttgaatcgaaagcaacggaaacagtcaggggccaactgttcgag
gttgcaccgcggtacacgaatttagcttacatcggagaaggtgcatacggcatggtcgtg
tcggccttcgacaatgtgaccaaggaaaaagtggccatcaagaagatctccccgttcgag
caccagacctactgccagaggacactgagggagatcaagatcctcacacggtttaagcac
gaaaatattatagacatcagagacatcatcagggcacccacaatcgaccagatgaaagat
gtctacattgtgcagtgcctgatggagactgacctgtacaagctgctcaagactcagaag
ctgagcaacgaccacatctgctacttcctctaccagatcctgaggggcctcaaatacatt
cattcggccaatgtgctgcacagggatctcaagcctagcaacctgctcctcaacaccact
tgtgacctcaagatctgcgactttggcctggcgcgggtggcggaccccgagcacgaccac
acgggcttcctgacggagtatgtggcgacgcggtggtaccgggcgccagagatcatgctg
aacagcaagggttacaccaagtctattgacatctggtctgtgggctgtatcctggcggag
atggtgtccaaccggcccatctttccgggcaagcactacctggaccagctgaaccacatc
ctgggcatcctaggctccccgtctcaggacgacctcaactgcatcatcaacgagaaggcc
cgctcctacctgcagtccctgccccacaaggccaagattccctggaccaagctgtacccg
gatgcagaccccaagggtaggcggggacatcaaaccattcttcccatggtatttcactgt
aaagggtcttgcagacgagacacggcatctgatgagctgcattgtttgtgcaccctgcag
ccgatggcggaagagccgttcaagtttgagacagagctggacgacctgcccaaggagcga
ctcaaggagctggtctttgaggagaccaacctgttccggtccaggtgccccaccaggccg
gcacagcagtcgtga

DBGET integrated database retrieval system