KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023785Help
Entry
IscW_ISCW023785   CDS       T01131                                 

Definition
alkaline phosphatase, putative (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:isc00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 513 aa AA seqDB search
SLCPLMCPVPEVPEDLEPKYWVQHGQDTLKRLLETDVVDAPAKNVIVFVGDGMGISTVTA
SRIYGGQLKGHRGEESSLSFERFPFTALVKTYAVDKQVTDSAASATALFCGAKTKYTMLG
VSAMANISECDSLAGHEMDSFIKRAQDKGMSTGLVTTTRVTHATPAALYTHSVHRDWEND
ARVPKDAVHKCKDIARQLIEDVPGKNLNVRGEEKKGASGITQQNLVCRDKQTGGGKRGDG
MNLIEDWKRSKQNRKFVTNREELLAVDTNATDYLLGLFADDHMAYELHRQEGSLKQPSLV
DMVTTAVKLLRRNENGFALMVEGGRIDHGHHENRAVLALRDAVELSNAVAAAMDLTSPKE
TLVLVTADHSHAFTLNGYAPRGNSILGSGGVSESDGMSYTTLSYANGPSTTRRKNETDTG
EKNASSDYQQAVLVPLKQETHGGEDVALYASGPMAHLVHGVLEQNVVAHIIEYAACLGDG
TTRRSKCLESSSAPCRLDFGLWAALAAFLLVFR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
agtttgtgtcctctaatgtgtccagtgcccgaagtgcctgaggacctggagcccaagtac
tgggtccagcatggtcaggacacactgaagcgactgcttgagaccgacgtggtggatgct
ccggccaagaacgtcatcgtcttcgtgggtgacggcatgggcatctccacggtgacggcg
tcccggatctacgggggacagctgaagggtcaccggggagaagagtccagcctctccttc
gagcgctttcccttcacggcgctggtcaaaacctacgcagtggacaagcaggtgacggac
agcgctgcttcagctacggcgctgttctgcggcgccaagaccaagtacaccatgctgggg
gtgtctgccatggccaacatttccgaatgtgactcgctggccggccacgaaatggattcc
ttcatcaagagggcgcaggacaaaggaatgtcgacgggcctggtgaccacgacgcgcgtg
acgcacgcgacgccggcggccctgtacactcattccgtgcaccgggactgggagaacgac
gcccgagtgcccaaggatgccgtccacaagtgcaaggacatcgccaggcagctcatcgag
gacgtgccgggcaagaacctcaacgtacgtggggaagaaaaaaaaggtgcctctggtatc
acgcaacagaacctggtttgccgcgacaagcagacgggcggcgggaagcgaggcgacggc
atgaacctcatcgaggactggaagaggtcgaagcagaaccgaaagttcgtcaccaacagg
gaggaactgctggccgtggataccaacgctactgactaccttctcgggctgttcgcggac
gatcacatggcctacgaacttcaccgccaggaaggttccttgaagcagccgtcgctagtg
gacatggtgaccacagctgtgaagctgctaagaagaaacgagaacgggtttgccctgatg
gtggaaggaggtcgcatagatcacggtcatcacgagaaccgggccgtcctcgctctccgg
gacgccgtagaactgagcaacgcagtggcggcggcgatggacctgaccagccccaaggag
accctggttctggtgaccgccgaccactcgcacgccttcacgctcaacggctacgccccg
aggggcaactccatcctcggcagcggcggggtgtccgagagcgacggcatgtcttacacg
actctctcgtacgccaacggaccctcgacaaccaggagaaagaacgagaccgacactggt
gagaagaacgcttcgtcagactaccagcaagcagtgctggtacccctgaagcaagagacc
cacggtggcgaggacgtggctctgtacgcttccggcccgatggcgcacctcgtccacgga
gtcctagagcagaacgtcgtggcgcacatcatcgagtacgcggcgtgtcttggcgacggc
acgacccgccgctccaagtgcctcgagtcctcctctgccccgtgccgactggactttggc
ctgtgggcggcgttggccgctttcctcctggtctttaggtag

DBGET integrated database retrieval system