KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023875Help
Entry
IscW_ISCW023875   CDS       T01131                                 

Definition
Munc13-3, putative
Orthology
K15293  
protein unc-13
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1092 aa AA seqDB search
EKCRDLLNADCLQRAAEKSTKHGAEDKANNIIMAMKERMKIRERDKPEIFELIREVFSVD
VKSHAGHQKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVGKTKKRT
RTMPRDLNPVWNEKFFFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEV
RTLSGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCE
HNAGVVKLPEAKGDDAWKVYFEENPEEIVDEFAMRYGIESIYQAMTHFHCLSTKYMCQGV
PAVMSTLLANINAYYAHTAASSAVSASDRFSASNFGKEKFVKLLDQLHNSLRIDLSMYRN
NFPASSPEKLQDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCAKACLRSTYQFLFE
NCYELFNREFQVDSQQGEKDEDHGPSLHNLDFWHKLIALMVSVIEEDRNSYAPVLNQFPQ
ELNVGQLSAVTMWSLFAVDMKYALEEHENQRLCKSSAYMNLHFKVKWFYNNYVKDISPYK
DSVPEYPAWFEPFVMQWLNENDDVSLDYLKSAFLRDKKDTFIQSSEHALFSNSVVDVFTQ
LTQCFDVISKLECPDPEIVKRYMKRFAKTIVKVLTAYADIVKKEFPNYVLQEKTACILMN
NIQQLRVQLEKLFESMGGEKLESDAGNILKELQQSLNCVLDDLSIVFAKSLEPTIKQSMG
ELSALLMGVKGSGQVSMNQTSQRNEVTAEADHVLHPLMDILDGKLTMFAQVCERTLTLVG
QPLQELWKIVMHTMEKTVVLPPMGEKNVSETLVSMGVLGKRFWSCGSATVVRVGLPLQEV
EKNLTPKQCAVLDVALDTIKQYFHAGGNGLKKTFLDKSPELQSLRYALSLYTQTTDTLIK
TFVTSQTKQDQPGADEGSVGEVSVQVDLFTHPGTGEHKITIELVAANDIKWPNTSMFRPF
VEVNLIGPHLSDKRRKHATKSKNNNWSPKYNETFHFIIGNEEEPSSFELHVCVKDYCFAR
DDRLVGVAVMQLRDIADQGSCACWLPLGRRIHMDETGWTILRILSQRTNDEVAREFVKLK
SELRNDENIPRN
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
gagaagtgccgcgacctgctcaacgccgactgccttcagagggcagcggagaaaagcacg
aaacacggagccgaagacaaagcaaacaacatcatcatggccatgaaggaaagaatgaag
attagggagcgcgataagcctgaaattttcgaattaatcagggaagtgtttagcgtggat
gttaagagccatgcgggccaccagaaggcggtaaagcaaagtgtccttgacggaacgtcc
aagtggtctgccaaaatagccatcactgtcatctgtgctcagggtctgatcgcgaaagat
aaaagcggaaccagcgacccttacgtgacggttcaggttggcaagacaaagaagagaaca
aggaccatgccgcgtgacctgaacccagtgtggaacgaaaagtttttcttcgagtgccat
aactcttcggaccgtatcaaagtgcgagtctgggatgaagacaacgacctgaagtcaaag
ttgcggcagaagttgacgagggagtcggacgattttctcggccaaacaatcatcgaagtc
cgaacactgagtggggagatggatgtctggtacaaccttgaaaagcggacggacaagtct
gcggtttccggtgccattcgcctccacatcagtgtagagattaagggtgaagagaaagtt
gcaccgtaccatgtgcagtacacatgtttacacgagaacctgtttcattacctatgtgaa
cacaacgctggagttgtaaaacttccagaagcgaaaggggacgacgcctggaaagtttac
tttgaagaaaatccagaggaaatagtggacgagtttgctatgcgatatgggattgaatca
atctaccaggcaatgacccacttccactgcctgtcgaccaagtacatgtgccaaggggta
cctgctgtgatgagcacccttcttgccaacatcaacgcctactatgcacacacggccgca
tcgtctgctgtctctgcgagcgaccgtttctcggcttctaattttgggaaagaaaagttt
gtaaagcttctagaccagttgcataattctctaagaatcgacctttctatgtacagaaat
aatttccctgcatcgtctccagagaagctacaggacctgaagtcaacagtggaccttctc
actagtatcaccttcttcaggatgaaggtgcaagagctgtcgagcccgccgagggcgagc
acggtggtgaaggactgcgccaaggcgtgcctgcggtccacgtaccagttcctgttcgag
aactgctacgagctgttcaaccgggagttccaggtggacagccagcagggggagaaagat
gaggaccacggccccagtctgcacaacctcgacttctggcacaagctcatcgccctcatg
gtctccgtcatcgaggaggaccgcaacagctatgcccctgtgctcaaccagttccctcaa
gagctcaacgtcgggcagttgagtgccgtgacgatgtggagcctttttgcggtcgacatg
aagtatgccctagaagaacacgagaaccaaaggttgtgcaagagttcagcgtacatgaac
ctccacttcaaggtcaagtggttctacaacaactatgtcaaggacatttctccctacaaa
gactcggtgcctgaataccctgcgtggtttgaaccttttgtgatgcaatggctcaatgag
aatgacgatgtttctctagattacctcaagagtgccttcctccgtgacaaaaaagacact
ttcattcagagctcggagcacgccctgttttccaattccgtggtggacgtttttacacaa
ctcacgcagtgctttgacgtcattagcaagctagagtgcccagaccctgagattgtgaag
cgctacatgaagcgctttgctaagacaattgtgaaagtactcactgcttatgcagacatt
gtaaagaaggaatttccaaattacgtcttgcaggaaaagacggcatgcattttaatgaac
aacattcaacaactaagggtgcaacttgagaaacttttcgagtctatgggaggtgaaaag
ctggagtctgatgcagggaacatattgaaagagcttcaacagtcactcaattgcgtccta
gatgaccttagcatagtgttcgcaaaaagcctggagccgaccatcaagcagagcatggga
gagctgagtgccctgctcatgggcgtgaagggcagcggccaggtttccatgaaccaaacg
tcgcagcgcaacgaggtgacggccgaggcagaccacgtgctacacccgctcatggacatc
ctagacgggaagctcaccatgtttgcacaggtctgcgagcgcaccctaacccttgttggt
caaccgttgcaggaactctggaagattgtgatgcacacgatggagaagacggtcgtgctt
ccaccaatgggagagaagaatgtgagtgaaacactggtttctatgggcgtccttggcaag
agattttggtcgtgtggctctgcaactgtggtcagagtgggcttacccttgcaggaggtg
gagaagaacctgacgccaaagcaatgtgctgtgttggacgtagccctggacacgatcaag
cagtacttccacgcgggtggcaacggcctcaagaagaccttcctggacaagagccctgaa
ctgcagagcctgcgctatgctctgtccctttacacacagaccacggacactctcatcaag
acttttgtcaccagccaaaccaaacaagatcagccgggtgcagacgaaggcagcgttggg
gaggtttcagttcaagtggacctgttcacacaccccggcaccggggagcacaagatcacc
attgaactggtggcggccaatgacatcaagtggcccaacacatccatgttccggcctttc
gtggaagtgaacctgattggtcctcacttgagcgacaagcgccgaaagcacgccaccaag
tccaagaacaacaactggtccccaaagtacaacgagaccttccacttcatcattgggaat
gaggaggaaccgtcgtcgttcgagctgcacgtctgcgtcaaggactactgctttgcccgc
gacgaccgtctggtgggcgtggccgtgatgcagctgcgcgacattgccgaccagggcagc
tgcgcctgctggctgcccctgggcaggcgcatccacatggacgagaccgggtggaccatc
ctgcggatcctctcgcagcgcaccaacgacgaggtcgcccgggagtttgtcaagctcaag
tcggagctgcgcaacgacgaaaacatcccccgcaactag

DBGET integrated database retrieval system