KEGG   Isoptericola variabilis: Isova_0167Help
Entry
Isova_0167        CDS       T01520                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
iva  Isoptericola variabilis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Isova_0167
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Isova_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
183860..184759
Genome map
AA seq 299 aa AA seqDB search
MASIVVVGSVNADLVVRTAAHPAPGETVLGSSLEVLPGGKGANQAVAAARLGADAALVGA
VGSDEFAEPATAGLRSAGVDLSGLAQVPGPTGIAIITVSDDGENTIVVVPGANGSVDADA
VRRHAQLVAGADVVVLQGEIPPSGIEEAARLAHGRVVLNLAPVLELPDDVTRLADPLVVN
EHEALRFLGIHEGEPHDVVRALVDAGPRSAVLTLGARGARVAERSGERTEVTAVAAPKVD
VVDTTGAGDAFVGALAWRLSAGDPLAVAAGFAARAGAHAATLSGAQPSFPAESSTLPTA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggcctcgatcgtcgtcgtcggatccgtcaacgccgacctcgtggtgcgcacggccgcg
caccccgctcccggcgagacggtgctcggctcgtcgctcgaggtgctgcccggcggcaag
ggtgcgaaccaggccgtcgccgccgctcggctcggagccgacgccgcgctggtcggcgcg
gtcggctccgacgagttcgcggagcccgcgacggcggggttgcggtccgcgggcgtggac
ctgtccgggctcgcgcaggtgcccggcccgaccggcatcgcgatcatcacggtctccgac
gacggcgagaacacgatcgtcgtcgtgcccggcgccaacggctccgtcgacgccgacgcc
gtgcgccggcacgcgcagctcgtcgccggcgccgacgtcgtcgtgctgcagggcgagatc
ccgccctccggcatcgaggaggccgcgcgcctcgcgcacggccgcgtggtcctcaacctc
gcgcccgtcctcgagctgcccgacgacgtcactcgcctcgccgatccgttggtcgtcaac
gagcacgaggcgctgaggttcctcggcatccatgaaggggagccgcacgacgtcgtgcgg
gcactcgtcgacgccggtccgcgatccgcggtgctcaccctcggtgcacgtggtgctcgc
gtcgcagagcgatccggagaacgtacggaggtaaccgcggtggcggctccgaaggtcgac
gtcgtggacaccaccggggccggcgacgcgttcgtcggcgccctggcctggcggctatcg
gctggcgacccgctcgccgtggcggccggcttcgccgcccgggcaggcgcccacgccgcg
accttaagcggtgcccaaccctcgttcccggcggaatcgagcacgctccctaccgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system