KEGG   Isoptericola variabilis: Isova_0185Help
Entry
Isova_0185        CDS       T01520                                 

Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
iva  Isoptericola variabilis
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:iva00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:iva00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:iva00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:iva00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(201848..202762)
Genome map
AA seq 304 aa AA seqDB search
MSRVVVVGAGVVGLSCAVRLLEAGHDVEILARELPARTTSATAAALWYPYLAFPHDRVTA
WAARSFEVFAELAAARPDAGVRLRAGTEVFAEAPADPWWRDAVPGLRRTADVPPSYTAGW
TFTAPVIDMPVYLAWLARRVAALGGSLTQTTVEAWPDGGTVVDCTGLGARDLAGDDAVEP
VRGQVLYLEQWGLERWWLDASGPTYVVPRLDEVVVGGTEQPGVRDLDPDTATAADILERA
ARLVPEVADARVLRHGVGLRPARPAVRVERDAADPRVVHCYGHGGAGVTLSWGCAEEVVG
LVAR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgtcgtcgtggtcggggccggagtcgtggggttgagctgcgcggtacggctg
ctcgaggccgggcacgacgtcgagatcctcgcccgcgagctgccggcccggaccacgtcc
gcgaccgccgccgcgctctggtacccgtacctcgcgttcccgcacgaccgcgtgaccgcg
tgggccgcccgctccttcgaggtcttcgccgagctggccgccgcccgcccggacgccggc
gtgcgcctgcgcgccggcacggaggtcttcgccgaggcgccggccgacccgtggtggcgc
gacgccgtgccgggtctgcgacgcacggccgacgtgccgccgtcgtacaccgcggggtgg
acgttcaccgcgcccgtgatcgacatgcccgtctacctcgcgtggctcgcgcggcgcgtc
gcggcgctgggcgggagcctcacgcagaccacggtcgaggcgtggcccgacggcgggacg
gtcgtcgactgcaccggtctcggcgcgcgggacctcgcgggcgacgacgcggtcgagccc
gtgcgcgggcaggtgctgtacctcgagcagtggggcctggagcgctggtggctcgacgcc
tccggcccgacgtacgtggtcccgcgcctggacgaggtcgtggtcggcggcaccgagcag
ccgggcgtgcgcgacctcgacccggacaccgccacggcggcggacatcctcgagcgcgcg
gcccggctcgtgcccgaggtcgccgacgcccgggtgctgcgccacggcgtcgggctgcgg
cccgcgcggcccgccgtgcgcgtggagcgcgacgccgccgacccgcgcgtcgtgcactgc
tacgggcacggcggggccggcgtcacgctgagctgggggtgcgccgaggaggtcgtcggc
ctggtcgcgcgctga

DBGET integrated database retrieval system