KEGG   Isoptericola variabilis: Isova_0495Help
Entry
Isova_0495        CDS       T01520                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
iva  Isoptericola variabilis
Brite
Enzymes [BR:iva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Isova_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
531183..532340
Genome map
AA seq 385 aa AA seqDB search
MSHPTTMTRVAAVAASAITALAVAMPAAQAAPPEPTLRSEAPRDVKIGSAVWGQRDLLDY
DPKNPTEFQRILAEEFNSLTPENDMKWAEIHPEEGVYDFSGADAVVAFAEANGQEVRGHT
LLWHSQNPQWVIDASATWTCEEARDVLEEHIRTVVGRYAGQIYEWDVANEIFQDTWDAGG
VRLRTEANPFLKACADDPVALIGDAFRWAHEADPEAVLFLNDYNAEGINTKTDAYYALVQ
ELLADGVPIHGFGAQGHLSLQYGFDESIQANFERFADLGLKVSVTEADVRMPLGEDGEPT
AEQIALQAERFDKMLEACLNVPACTSYTVWGFDDARSWVPGVFPEGYATIMTEDFEKKPS
YYALLESLTEATPGKSPRTPPGLNK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcccacgaccatgacccgcgtcgccgccgtcgcggcgtcggcgatcaccgca
ctggcggtggcgatgcccgcggcccaggccgctccgccggagccgaccctgcgatccgag
gcgccgcgcgacgtcaagatcggcagcgccgtgtggggtcagcgtgacctgctcgactac
gacccgaagaacccgaccgagttccagcgcatcctcgccgaggagttcaactcgctcacc
cccgagaacgacatgaagtgggccgagatccacccggaggagggcgtctacgacttctcc
ggtgcggacgccgtcgtggcgttcgccgaggccaacggccaggaggtccgcggccacacg
ctgctctggcacagccagaacccgcagtgggtgatcgacgccagcgccacgtggacctgc
gaggaggcccgcgacgtcctcgaggagcacatccgcaccgtcgtcggccggtacgccggc
cagatctacgagtgggacgtcgccaacgagatcttccaggacacctgggacgccggcggc
gtgcgcctgcgcaccgaggccaacccgttcctcaaggcctgtgccgacgacccggtcgcc
ctcatcggtgacgccttccgttgggcgcacgaggccgaccccgaggcggtcctcttcctc
aacgactacaacgccgagggcatcaacaccaagaccgacgcctactacgccctggtgcag
gagctcctcgccgacggcgtgccgatccacggcttcggcgcccagggccacctgagcctg
cagtacggcttcgacgagtcgatccaggccaacttcgagcggttcgcggacctggggctc
aaggtgtccgtcaccgaggccgacgtgcgcatgccgctcggcgaggacggcgagccgacc
gccgagcagatcgcgctccaggccgagcggttcgacaagatgctcgaggcgtgcctcaac
gtgcctgcctgcacgagctacaccgtctggggcttcgacgacgcccgctcgtgggtcccg
ggcgtcttcccggagggctacgcgacgatcatgaccgaggacttcgagaagaagccctcg
tactacgccctgctcgagagcctcaccgaggccaccccgggcaagtcgccgcgcacgccg
ccgggcctgaacaagtag

DBGET integrated database retrieval system