KEGG   Isoptericola variabilis: Isova_0533Help
Entry
Isova_0533        CDS       T01520                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
iva  Isoptericola variabilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Isova_0533
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Isova_0533
Exosome [BR:iva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Isova_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(573770..575284)
Genome map
AA seq 504 aa AA seqDB search
MADYVLAIDQGTTSSRAIIFDHSGRIISTGQLEHDQIFPRAGWVEHNPEQIWNNVREVVG
LALTRANLTHTDLAAIGITNQRETAVVWDRTTGKPVYNAIVWQDTRTQAIVDELGGDVGA
DKYKSIVGLPLATYFSGPKIKWILDNVDGAREAAERGDLLFGNTDTWVLWNMTGGVEGGV
HVTDVTNASRTMLMDLDTLSWREDIAADMGIPLSMLPEIRSSSEVYGQGRPRGMVPGVPI
AGILGDQQAATFGQACFEVGTAKNTYGTGNFMLLNTGTEKVPSKNGLLTTVCYKIGDAPQ
VYALEGSIAVTGSLVQWLRDNLGLFTDAPDIEWLAGKVDDNGGAYFVPAFSGLFAPYWRP
DARGALVGLTRYVNRNHIARAALEATAYQTREVMDAMNADSGVDLTELKVDGGMVANELL
MQFQADQLGVDVVRPKVAETTALGAAYAAGIAVGFWNGEEDVTANWAEDKRWSPSMAEDE
RERLYRQWKKAVTKTFDWVDEDVQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggctgactacgtcctcgccatcgaccagggcacgacgagctcgcgtgccatcatcttc
gaccactcgggccgtatcatctcgaccggccagctcgagcacgaccagatcttccccagg
gcgggctgggtcgagcacaaccccgagcagatctggaacaacgtgcgcgaggtcgtcggc
ctcgccctgacccgcgccaacctcacccacaccgacctcgccgcgatcggcatcaccaac
cagcgcgagaccgccgtcgtgtgggaccggacgacgggcaagcccgtgtacaacgcgatc
gtctggcaggacacgcgcacgcaggcgatcgtcgacgagctgggcggcgacgtcggggcc
gacaagtacaagtcgatcgtcggcctgcccctcgcgacgtacttctcgggtcccaagatc
aagtggatcctcgacaacgtcgacggcgcccgcgaggccgccgagcgcggcgacctgctc
ttcggcaacaccgacacgtgggtcctgtggaacatgaccggcggcgtcgagggcggcgtg
cacgtcaccgacgtcaccaacgcctcgcgcaccatgctcatggacctcgacacgctgtcg
tggcgcgaggacatcgcggccgacatgggcatcccgctgtcgatgctgcccgagatccgc
tcgtcgtccgaggtgtacggccagggccgcccccgcggcatggtgcccggcgtgccgatc
gccggcatcctcggcgaccagcaggcggccacgttcggccaggcgtgcttcgaggtcggc
accgcgaagaacacgtacggcaccggcaacttcatgctcctcaacacgggcaccgagaag
gtcccgagcaagaacggcctgctcacgacggtctgctacaagatcggcgacgccccgcag
gtgtacgcgctcgagggctcgatcgccgtcaccggctctctcgtgcagtggctccgcgac
aacctgggtctgttcaccgacgcgcccgacatcgagtggctcgcgggcaaggtcgacgac
aacggcggcgcgtacttcgtgcccgcgttctccggcctgttcgcgccgtactggcggccc
gacgcgcgcggcgcgctcgtcggcctcacccggtacgtcaaccgcaaccacatcgcgcgc
gcggcgctcgaggccacggcctaccagacgcgcgaggtcatggacgccatgaacgccgac
tcgggcgtcgacctcaccgagctcaaggtcgacggcggcatggtcgccaacgagctgctc
atgcagttccaggccgaccagctcggcgtcgacgtcgtgcggcccaaggtcgccgagacg
acggcgctcggtgccgcgtacgcggcgggcatcgccgtcgggttctggaacggcgaggag
gacgtcaccgccaactgggccgaggacaagcgctggtcgccgtccatggccgaggacgag
cgcgagcggctctaccggcagtggaagaaggccgtgacgaagacgttcgactgggtggac
gaggacgtgcagtag

DBGET integrated database retrieval system