KEGG   Isoptericola variabilis: Isova_0608Help
Entry
Isova_0608        CDS       T01520                                 

Definition
FHA domain-containing protein
Orthology
K03466  
DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
iva  Isoptericola variabilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
651822..656291
Genome map
AA seq 1489 aa AA seqDB search
MRVKVTLRRPDSTQDDVVITADAGATIGEVASTLARVDPRHPAPDGARRTLEARLPGQER
PVRLPADAALGEAWIGSGAEIAVVDLDRPGFDYPGSRDVRATLHFDGGQTIDLAEGSWVV
GRAPSCDVVLNDPLVSKRHLRVDVGDVVEVVDLGSANGVLVDGAHVQRLRVEGRQKVVVG
DTAITVERRRPTTLTGVAPKAGPVPFTRSPRVEPRYKGQEFEAPEVPQETEPKDFPYLLL
LAPILMGGAMYVATGRVMALMFVFLAPLMMIGNHVTRGRQERKRKERDVARFDERLQGLR
DALGGEEETERSVRLREAPATQHVFVEAMRHGPLLWTRRPEHWSFLNVRFGVGTMPSRNS
VKTGGKGALIKEYQERLDAVVDRHTDVSGVPVVENLYDAGALGFAGPPAQVIGSLNAVLL
QLTGLHAPSELVVTGMVSPVWTSHLQWLTWIPHTSSPHSPIEGHHLADSATGAARLVAEL
EELVTTRLRAQRGRARRRGAIDEDDAALERGADVGSTSQEAGTKSPVPAVVVVVSDDIDV
DRARLVQLAEQGPDAGVYLLWIAADTARLPAACRTFVDLGEHGPRVGMVRLGRWVDDVEL
EEVDAPTALEYGRRLAPVYDAGAIVEDASDLPRSISLPALLGHDLFEDPRAVLERWRQNQ
SVYDRTTPRPRKRAGSLRAIVGSAGVDAQHLDLRSQGPHALVGGTTGAGKSEFLQAWVLG
MAAEYSPDRVTFLFVDYKGGSAFADCVNLPHCVGLVTDLSPHLVLRALTSLRAELHHREH
LFNRKKAKDLLELEKRGDPETPPALVIVIDEFAALVGDVPEFVDGVVDVAQRGRSLGIHL
IMATQRPAGVIKDNLRANTNLRVALRMADESDSSDVVDIKDAAHIDPGIPGRGVVKTGPG
RVQAFQSGYAGGWSTRAPERTAIEVAGLHFGREERWEEPVAPSRDDDVDLGPNDQQRLVA
RITEAFRMGGLPTPRRPWLDSLADVYDLTRLHQRTDTELLVGVADVPEQQAQRPVYFVPD
LDGHLGVYGTSGAGKSTALRSIATAAGITPRGGPVHVYGLDFAAGSLRMLRALPHVGTVA
RGDDTERVVGLLRMLRDELARRGEEFAAVSASSVTEYRRLTGRADVPRILLLVDGFPAFR
DDFETGAGRAEWFDVFRDILNDGRGLGMHVVFSADRSGAVPTYVRSMVQRNLLLRLTDDG
YLAFNAPRDVITAESPAGRGLLDGLEVQVAVVGGTTSVSAQAAATEKLGASMRAAGVLEA
PAVRVLPTEYPAADLPDHVDGRPVLGLEGIGLTPQPFDPTGTIVVAGPPGSGRSNALVTI
ASAVRRANPSARCYLFGQPRSAIAGALPWEEVASGPDKVAALAKDLLAAVQDEDVEPGIV
VVVEGINDYLQSPADKPIQDLTKAIRASDHLLVAEAETAAWTSTWPLLSEVKNGRRGLLL
QPENLDGDTILKTSLPRSGKGEFPVGRGAWVARGKHVRVQLPLVLGGGS
NT seq 4470 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcaaggtgacgctgcggcgccccgacagcacccaggacgacgtcgtcatcacc
gccgacgccggcgcgacgatcggcgaggtcgcgtcgacgctcgcgcgcgtcgacccgcgc
caccctgcccccgacggcgcccggcgcacgctcgaggcgcgcctgcccggccaggagcgg
cccgtgcgactgcccgccgacgccgcgctcggcgaggcatggatcggctccggcgccgag
atcgccgtcgtcgacctcgaccggcccggcttcgactaccccggctcgcgcgacgtgcgc
gcgacgctgcacttcgacggcggccagacgatcgacctcgccgagggcagttgggtcgtc
gggcgcgcgccgtcgtgcgacgtcgtcctcaacgacccgctcgtgtccaagcggcacctg
cgcgtcgacgtgggcgacgtcgtcgaggtcgtcgacctgggctcggccaacggtgtgctc
gtcgacggcgcgcacgtgcagcggctgcgcgtcgaggggcggcagaaggtcgtcgtcggc
gacacggcgatcacggtcgagcgccggcggcccacgacgctgaccggcgtcgcgcccaag
gcgggtcccgtgccgttcacgcgctcgccgcgcgtcgagccgcggtacaagggccaggag
ttcgaggcgcccgaggtcccgcaggagaccgagcccaaggacttcccgtacctcctgctg
ctcgcgccgattctcatgggcggcgcgatgtacgtcgcgacgggccgcgtcatggcgctg
atgttcgtcttcctcgcgccgctcatgatgatcggcaaccacgtcacgcgcgggcgtcag
gagcgcaagcgcaaggagcgcgacgtcgcgcggttcgacgagcggctccagggcctgcgc
gacgcgctcggcggcgaggaggagaccgagcggtcggtccgcctgcgtgaggcgccggcc
acgcagcacgtgttcgtcgaggccatgcggcacggcccgctgctgtggacccgcaggccc
gagcactggagcttcctcaacgtgcggttcggcgtcggcacgatgccgtcgcgcaactcg
gtcaagacgggcggcaagggcgcgctcatcaaggagtaccaggagcggctcgacgcggtc
gtggaccggcacacggacgtctcgggcgtgccggtcgtcgagaacctctacgacgcgggt
gccctcggcttcgccgggccgcccgcccaggtcatcggcagcctcaacgcggtgctgctc
cagctcacgggcctgcacgcgccgtcggagctcgtcgtgacgggcatggtgagcccggtg
tggacctcgcacctgcagtggctcacgtggatcccgcacacctcgtcgccgcacagcccg
atcgaggggcaccacctcgccgactcggcgacgggggccgcacgtctcgtggccgagctc
gaggagctggtgacgacgcggctgcgcgcgcagcgcggccgcgcccgccgtcgcggcgcg
atcgacgaggacgacgccgcgctcgagcggggcgcggacgtcggcagcacgagccaggag
gccgggacgaagtcgcccgtgcccgccgtcgtcgtggtcgtctccgacgacatcgacgtc
gaccgcgcccggctcgtccagctcgcggagcagggccccgacgccggcgtgtacctcctg
tggatcgccgccgacacggcccggctgcccgccgcgtgccgcacgttcgtcgacctcggc
gagcacggcccgcgcgtgggcatggtccgcctcggccggtgggtcgacgacgtcgagctc
gaggaggtcgacgcgccgaccgcgctcgagtacggccgtcgcctcgcgcccgtgtacgac
gccggcgcgatcgtcgaggacgcgagcgacctgccgcgctcgatctcgctgcccgcgctc
ctgggccacgacctgttcgaggacccgcgcgcggtgctcgagcggtggcggcagaaccag
tcggtctacgaccgcacgacgccgcgaccgcgcaagcgcgcggggagcctgcgcgcgatc
gtcggctcggccggcgtcgacgcccagcacctcgacctgcgctcgcagggcccgcacgcg
ctcgtgggcggcacgacgggcgcgggcaagtccgagttcctccaggcgtgggtgctcggc
atggccgcggagtacagccccgaccgcgtgacgttcctcttcgtcgactacaagggcggc
tcggcgttcgccgactgcgtcaacctgccgcactgcgtcggcctcgtgaccgacctgtcg
ccgcacctcgtgctgcgcgccctgacgagcctgcgggccgagctgcaccaccgcgagcac
ctgttcaaccgcaagaaggccaaggacctgctcgagctcgagaagcgcggcgaccccgag
acgccgcccgcgctcgtcatcgtcatcgacgagttcgctgcgctcgtgggcgacgtgccg
gagttcgtcgacggggtcgtcgacgtcgcgcagcgcggccgctcgctgggcatccacctc
atcatggcgacccagcgccccgcgggcgtcatcaaggacaacctgcgggccaacaccaac
ctgcgcgtcgcgctccgtatggccgacgagtccgactcgagcgacgtcgtcgacatcaag
gacgccgcccacatcgaccccggcatcccggggcggggtgtggtcaagacggggcccggt
cgcgtgcaggcgttccagtccgggtacgcgggcgggtggagcacgcgcgcgcccgagcgg
acggcgatcgaggtcgcgggcctgcacttcggccgcgaggagcgctgggaggagccggtc
gccccgtcgcgcgacgacgacgtcgacctcggcccgaacgaccagcagcggctcgtcgcg
cgcatcaccgaggcgttccggatgggcggcctgccgacgccgcggcggccctggctcgac
tcgctcgccgacgtctacgacctcacgcgcctgcaccagcggaccgacaccgagctgctc
gtcggcgtggcggacgtccccgagcagcaggcgcagcggcccgtctacttcgtgcccgac
cttgacggccacctgggcgtgtacggcacgagcggcgcgggcaagagcaccgcgctgcgc
tcgatcgccacggccgcgggcatcacgccgcgcggcgggcccgtccacgtgtacgggctc
gacttcgcggccggctcgctgcgcatgctgcgggcgctgccgcacgtcggcacggtcgcg
cgcggcgacgacaccgagcgcgtcgtcggcctgctgcgcatgctgcgcgacgagctcgcc
cgccgcggcgaggagttcgccgcggtctcggcgtcgagcgtgacggagtaccgccggctc
acggggcgcgccgacgtgccgcgcatcctgctgctcgtcgacgggttccccgcgttccgc
gacgacttcgagacgggcgccggccgcgccgagtggttcgacgtcttccgcgacatcctc
aacgacgggcgcggcctgggcatgcacgtggtgttcagcgccgaccgctcgggcgccgtg
ccgacgtacgtgcgctcgatggtccagcgcaacctgctgctgcgcctcaccgacgacggc
tacctcgccttcaacgcgccgcgcgacgtcatcaccgcggagtcgcccgcgggccgcggc
ctgctcgacggcctggaggtccaggtcgcggtcgtcgggggcacgacgtcggtctccgcg
caggccgccgcgaccgagaagctgggcgcgtcgatgcgcgccgcgggcgtcctcgaggcg
ccggcggtgcgcgtgctgcccacggagtacccggcggccgacctgcccgaccacgtggac
gggcgtccggtgctgggccttgagggcatcgggctgacgccgcagccgttcgacccgacg
ggcacgatcgtcgtggccgggccgcccgggtcgggacgcagcaacgcgctcgtcaccatc
gcctcggccgtgcgccgcgccaacccgtcggcgcgctgctacctcttcggtcagccgcgg
tccgcgatcgcgggcgcgctgccgtgggaggaggtcgcgagcggcccggacaaggtcgcg
gcgctcgccaaggacctgctcgccgcggtccaggacgaggacgtcgagccgggcatcgtc
gtcgtggtcgagggcatcaacgactacctccagtcgcctgccgacaagccgatccaggac
ctcaccaaggcgatccgggccagcgaccacctgctggtcgccgaggcggagacggcggcg
tggacctcgacgtggccgctgctgtcggaggtcaagaacgggcgtcgcggcctgctgctg
cagcccgagaacctcgacggcgacacgatcctcaagacgtcgctgccgcggtccggcaag
ggcgagtttcccgtcggccgcggcgcgtgggtcgcgcggggcaagcacgtgcgcgtgcag
ctcccgctcgtcctcggcggcgggtcgtga

DBGET integrated database retrieval system