KEGG   Isoptericola variabilis: Isova_0730Help
Entry
Isova_0730        CDS       T01520                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
iva  Isoptericola variabilis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Isova_0730
Enzymes [BR:iva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Isova_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(774320..776806)
Genome map
AA seq 828 aa AA seqDB search
MTTTTSTSAWRATGVAELDQADLERLDRWWRAANYLSVGQIYLLDNPLLREPLTRDHVKP
RLLGHWGTTPGLTFLYAHLSRAIKAREQSTIYITGPGHGGPGLVASAYLEGTYSEVYSDV
TQDAEGMRRLFRQFSFPGGVPSHVAPETPGSIHEGGELGYALSHAYGAAFDNPDLLVAAV
VGDGEAETGPLATSWHSNKFLNPAQDGVVLPILHLNGYKIANPTVFDRIPQDELRDLMVG
YGHRPYFFEGGYDRDEPPLEVHRRFAALLDEVLDEIAAIKARAADGDLARPRWPMIVFRT
PKGWSGPEEIDGKKTTGSWRAHQVPLASARDTEEHLRTLEDWLRSYRPEELFDDDGRLVD
DVASLTPEGHLRMSDNPHANGGLLLHDLRLPDFRDYAVDVPSPGGAIAEAPRVLGRWLTD
VIRRNPDNFRIFGPDETASNRLQAVYDATDKQWNAEIVGPEVDEHLARAGRVMEMLSEHQ
VQGWLEGYLLTGRHGLMNSYEAFIHIVDSMFNQHAKWLKVTNHIPWRRPIASLNYLLSSH
VWRQDHNGFSHQDPGFIDHVVNKKAEIVRVYLPPDANTLLSTYDHCLRSRQYVNVVVAGK
QPSPQFLSMDEAVAHCTRGLGIWEWAGTEVPGEDPDVVLAAAGDVPTLEVLAAADILRRE
LPDLKVRVVNVVDLMRLQDEREHPHGLSDTQFDGLFTTDRPIIFAYHGYPWLIHRLTYRR
TGHANLHVRGYKEEGTTTTPFDMVMLNDVDRYHLVIDVIDRVDGLGQRHAGLRQRMVDAR
IRARAWTREHGEDIPEVRDWVWPDVGQTATEEGGPQYAGAQDTGGDNE
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgaccagcacctccgcctggcgcgccaccggcgtcgccgagctggaccag
gccgacctcgagcgcctcgaccggtggtggcgcgccgcgaactacctctcggtcgggcag
atctacctgctcgacaacccgctgctgcgcgagcccctcacgcgcgaccacgtcaagccg
cgcctcctcgggcactggggcaccacgccggggctcacgttcctctacgcgcacctgtcg
cgggcgatcaaggcccgtgagcagtcgacgatctacatcacgggcccgggccacggcggc
cccggcctcgtcgcgagcgcgtacctcgagggcacgtactccgaggtgtactcggacgtg
acccaggacgccgagggcatgcgccggctgttccggcagttctccttcccgggaggcgta
ccgtcgcacgtcgcgcccgagacgcccggctcgatccacgagggcggcgagctcggctac
gcgctgagccacgcgtacggggcggcgttcgacaaccccgacctgctcgtcgcggccgtc
gtgggcgacggcgaggccgagaccggcccgctcgccacgagctggcactcgaacaagttc
ctcaacccggcgcaggacggcgtcgtgctgccgatcctgcacctcaacgggtacaagatc
gccaacccgacggtcttcgaccggatcccgcaggacgagctgcgcgacctgatggtcggg
tacggccaccggccgtacttcttcgagggcggctacgaccgcgacgagccgccgctcgag
gtgcaccgccgcttcgccgccctgctcgacgaggtgctcgacgagatcgcggcgatcaag
gcccgcgcggcggacggcgacctcgcccggccgcggtggcccatgatcgtcttccgcacg
cccaaggggtggtccggcccggaggagatcgacggcaagaagacgaccgggtcatggcgg
gcgcaccaggtgccgctcgcgagcgcccgcgacaccgaggagcacctgcggaccctcgag
gactggctgcgctcgtaccgcccggaggagctgttcgacgacgacggccgcctcgtcgac
gacgtcgcgtcgctcacgcccgaggggcacctgcgcatgagcgacaacccccacgccaac
ggcggcctgctgctgcacgacctgcgcctgcccgacttccgcgactacgcggtcgacgtg
ccgtcgcccggcggggcgatcgccgaggcgccgcgcgtgctcgggcggtggctcaccgac
gtgatccgccgcaacccggacaacttccggatcttcggcccggacgagacggcgtcgaac
cggctccaggcggtgtacgacgcgaccgacaagcagtggaacgccgagatcgtcgggccc
gaggtcgacgagcacctcgcccgcgcgggccgcgtcatggagatgctctcggagcaccag
gtgcagggctggctcgagggctacctgctcaccggccggcacggcctgatgaacagctac
gaggcgttcatccacatcgtcgactcgatgttcaaccagcacgccaagtggctcaaggtc
accaaccacatcccgtggcggcggccgatcgcgagcctcaactacctgctgtcgagccac
gtgtggcgccaggaccacaacggcttcagccaccaggacccgggcttcatcgaccacgtc
gtgaacaagaaggccgagatcgtccgggtgtacctgccgccggacgccaacaccctgctg
agcacctacgaccactgcctgcgcagccggcagtacgtcaacgtcgtcgtggcgggcaag
cagccctcgccgcagttcctgtcgatggacgaggcggtcgcgcactgcacgcgtggcctc
ggcatctgggagtgggccggcaccgaggtgccgggcgaggaccccgacgtcgtgctcgcg
gccgcgggcgacgtcccgaccctcgaggtgctcgccgcggccgacatcctgcgccgcgag
ctgcccgacctcaaggtgcgcgtcgtcaacgtcgtcgacctcatgcggctccaggacgag
cgcgagcacccgcacggcctgtcggacacgcagttcgacggcctgttcaccacggacagg
ccgatcatcttcgcctaccacggctacccgtggctcatccaccgcctcacgtaccggcgc
accggccacgccaacctgcacgtgcgcgggtacaaggaggagggcaccacgaccacgccg
ttcgacatggtcatgctcaacgacgtcgaccgctaccacctggtcatcgacgtcatcgac
cgcgtcgacggcctgggccagcggcacgccggcctgcgccagcgcatggtcgacgcccgc
atccgcgcccgggcctggacgcgcgagcacggcgaggacatccccgaggtccgcgactgg
gtgtggcccgacgtcgggcagaccgcgaccgaggagggcggcccgcagtacgcgggcgcg
caggacaccggcggcgacaacgagtga

DBGET integrated database retrieval system