KEGG   Isoptericola variabilis: Isova_0730Help
Entry
Isova_0730        CDS       T01520                                 

Definition
(GenBank) phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
iva  Isoptericola variabilis
Pathway
iva00030  Pentose phosphate pathway
iva01100  Metabolic pathways
iva01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Isova_0730
Enzymes [BR:iva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Isova_0730
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Isova_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEG43516
JGI: Isova_0730
UniProt: F6FWU4
Position
complement(774320..776806)
Genome map
AA seq 828 aa AA seqDB search
MTTTTSTSAWRATGVAELDQADLERLDRWWRAANYLSVGQIYLLDNPLLREPLTRDHVKP
RLLGHWGTTPGLTFLYAHLSRAIKAREQSTIYITGPGHGGPGLVASAYLEGTYSEVYSDV
TQDAEGMRRLFRQFSFPGGVPSHVAPETPGSIHEGGELGYALSHAYGAAFDNPDLLVAAV
VGDGEAETGPLATSWHSNKFLNPAQDGVVLPILHLNGYKIANPTVFDRIPQDELRDLMVG
YGHRPYFFEGGYDRDEPPLEVHRRFAALLDEVLDEIAAIKARAADGDLARPRWPMIVFRT
PKGWSGPEEIDGKKTTGSWRAHQVPLASARDTEEHLRTLEDWLRSYRPEELFDDDGRLVD
DVASLTPEGHLRMSDNPHANGGLLLHDLRLPDFRDYAVDVPSPGGAIAEAPRVLGRWLTD
VIRRNPDNFRIFGPDETASNRLQAVYDATDKQWNAEIVGPEVDEHLARAGRVMEMLSEHQ
VQGWLEGYLLTGRHGLMNSYEAFIHIVDSMFNQHAKWLKVTNHIPWRRPIASLNYLLSSH
VWRQDHNGFSHQDPGFIDHVVNKKAEIVRVYLPPDANTLLSTYDHCLRSRQYVNVVVAGK
QPSPQFLSMDEAVAHCTRGLGIWEWAGTEVPGEDPDVVLAAAGDVPTLEVLAAADILRRE
LPDLKVRVVNVVDLMRLQDEREHPHGLSDTQFDGLFTTDRPIIFAYHGYPWLIHRLTYRR
TGHANLHVRGYKEEGTTTTPFDMVMLNDVDRYHLVIDVIDRVDGLGQRHAGLRQRMVDAR
IRARAWTREHGEDIPEVRDWVWPDVGQTATEEGGPQYAGAQDTGGDNE
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgaccagcacctccgcctggcgcgccaccggcgtcgccgagctggaccag
gccgacctcgagcgcctcgaccggtggtggcgcgccgcgaactacctctcggtcgggcag
atctacctgctcgacaacccgctgctgcgcgagcccctcacgcgcgaccacgtcaagccg
cgcctcctcgggcactggggcaccacgccggggctcacgttcctctacgcgcacctgtcg
cgggcgatcaaggcccgtgagcagtcgacgatctacatcacgggcccgggccacggcggc
cccggcctcgtcgcgagcgcgtacctcgagggcacgtactccgaggtgtactcggacgtg
acccaggacgccgagggcatgcgccggctgttccggcagttctccttcccgggaggcgta
ccgtcgcacgtcgcgcccgagacgcccggctcgatccacgagggcggcgagctcggctac
gcgctgagccacgcgtacggggcggcgttcgacaaccccgacctgctcgtcgcggccgtc
gtgggcgacggcgaggccgagaccggcccgctcgccacgagctggcactcgaacaagttc
ctcaacccggcgcaggacggcgtcgtgctgccgatcctgcacctcaacgggtacaagatc
gccaacccgacggtcttcgaccggatcccgcaggacgagctgcgcgacctgatggtcggg
tacggccaccggccgtacttcttcgagggcggctacgaccgcgacgagccgccgctcgag
gtgcaccgccgcttcgccgccctgctcgacgaggtgctcgacgagatcgcggcgatcaag
gcccgcgcggcggacggcgacctcgcccggccgcggtggcccatgatcgtcttccgcacg
cccaaggggtggtccggcccggaggagatcgacggcaagaagacgaccgggtcatggcgg
gcgcaccaggtgccgctcgcgagcgcccgcgacaccgaggagcacctgcggaccctcgag
gactggctgcgctcgtaccgcccggaggagctgttcgacgacgacggccgcctcgtcgac
gacgtcgcgtcgctcacgcccgaggggcacctgcgcatgagcgacaacccccacgccaac
ggcggcctgctgctgcacgacctgcgcctgcccgacttccgcgactacgcggtcgacgtg
ccgtcgcccggcggggcgatcgccgaggcgccgcgcgtgctcgggcggtggctcaccgac
gtgatccgccgcaacccggacaacttccggatcttcggcccggacgagacggcgtcgaac
cggctccaggcggtgtacgacgcgaccgacaagcagtggaacgccgagatcgtcgggccc
gaggtcgacgagcacctcgcccgcgcgggccgcgtcatggagatgctctcggagcaccag
gtgcagggctggctcgagggctacctgctcaccggccggcacggcctgatgaacagctac
gaggcgttcatccacatcgtcgactcgatgttcaaccagcacgccaagtggctcaaggtc
accaaccacatcccgtggcggcggccgatcgcgagcctcaactacctgctgtcgagccac
gtgtggcgccaggaccacaacggcttcagccaccaggacccgggcttcatcgaccacgtc
gtgaacaagaaggccgagatcgtccgggtgtacctgccgccggacgccaacaccctgctg
agcacctacgaccactgcctgcgcagccggcagtacgtcaacgtcgtcgtggcgggcaag
cagccctcgccgcagttcctgtcgatggacgaggcggtcgcgcactgcacgcgtggcctc
ggcatctgggagtgggccggcaccgaggtgccgggcgaggaccccgacgtcgtgctcgcg
gccgcgggcgacgtcccgaccctcgaggtgctcgccgcggccgacatcctgcgccgcgag
ctgcccgacctcaaggtgcgcgtcgtcaacgtcgtcgacctcatgcggctccaggacgag
cgcgagcacccgcacggcctgtcggacacgcagttcgacggcctgttcaccacggacagg
ccgatcatcttcgcctaccacggctacccgtggctcatccaccgcctcacgtaccggcgc
accggccacgccaacctgcacgtgcgcgggtacaaggaggagggcaccacgaccacgccg
ttcgacatggtcatgctcaacgacgtcgaccgctaccacctggtcatcgacgtcatcgac
cgcgtcgacggcctgggccagcggcacgccggcctgcgccagcgcatggtcgacgcccgc
atccgcgcccgggcctggacgcgcgagcacggcgaggacatccccgaggtccgcgactgg
gtgtggcccgacgtcgggcagaccgcgaccgaggagggcggcccgcagtacgcgggcgcg
caggacaccggcggcgacaacgagtga

DBGET integrated database retrieval system