KEGG   Isoptericola variabilis: Isova_0761Help
Entry
Isova_0761        CDS       T01520                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
iva  Isoptericola variabilis
Pathway
iva00020  Citrate cycle (TCA cycle)
iva00640  Propanoate metabolism
iva00660  C5-Branched dibasic acid metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
iva01130  Biosynthesis of antibiotics
iva01200  Carbon metabolism
Module
iva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
iva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isova_0761
   00640 Propanoate metabolism
    Isova_0761
   00660 C5-Branched dibasic acid metabolism
    Isova_0761
Enzymes [BR:iva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Isova_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CaMBD
Motif
Other DBs
NCBI-ProteinID: AEG43547
JGI: Isova_0761
UniProt: F6FWX5
Position
808696..809862
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQARDIFEKHGVPVLGGVVATTPEEARAGAEKLGGGTVVVKAQVKTGGRGKAGGV
KLAHSPEEAAEKAREILGMDIKGHTVHRVMIAQGAKIAEEYYFSVLLDRANRSYLAMCSV
EGGMEIEQLAVERPEALAKVPVDPTVGIDAAKAAEIVEAAGFADDLKDAVADVIQKLWTV
YKAEDATLVEVNPLVKTEDGQIVALDGKVSLDDNASFRHPEHEELEDTAAADPLEAKAKE
NDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAAVMAAGL
DVILSDPQVKSVFVNVFGGITACDAVANGIVQALEILGDKENKPLVVRLDGNNVEEGRRI
LTEANHPLVTLAETMDGGADKAAELANA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgaataccaggcgcgcgacatcttcgagaagcacggcgtgcccgtgctg
ggcggggtcgtcgcgacgacgcccgaggaggcccgcgcgggcgccgagaagctcggcggc
ggcaccgtggtcgtcaaggcccaggtcaagaccggcggccgtggcaaggccggcggcgtg
aagctggcccactcgcccgaggaggcggccgagaaggcgcgcgagatcctcggcatggac
atcaagggccacacggtccaccgcgtgatgatcgcgcagggcgccaagatcgccgaggag
tactacttctcggtgctcctggaccgcgcgaaccgctcctacctggcgatgtgctcggtc
gagggcggcatggagatcgagcagctcgccgtcgagcgccccgaggcgctcgccaaggtc
ccggtcgacccgaccgtcggcatcgacgctgccaaggccgccgagatcgtcgaggccgcg
ggcttcgcggacgacctcaaggacgccgtcgccgacgtgatccagaagctgtggacggtc
tacaaggccgaggacgccacgctcgtcgaggtcaacccgctggtcaagacggaggacggc
cagatcgtcgccctcgacggcaaggtctcgctcgacgataacgcgtcgttccgccacccc
gagcacgaggagctcgaggacacggccgcggccgacccgctcgaggccaaggccaaggag
aacgacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggc
ctcgtcatgagcacgctcgacgtcgtcgcgtacgccggcgagaagcacggcggcgtcaag
ccggcgaacttcctggacatcggcggcggcgcctcggcggccgtcatggcggccggcctc
gacgtcatcctgtccgacccccaggtcaagagcgtcttcgtcaacgtcttcggcgggatc
accgcctgcgacgccgtcgcgaacggcatcgtgcaggccctcgagatcctgggcgacaag
gagaacaagccgctcgtcgtgcgcctcgacggcaacaacgtcgaggagggccgccgcatc
ctcaccgaggcgaaccacccgctcgtgaccctggccgagaccatggacggcggggccgac
aaggccgccgagctggccaacgcctga

DBGET integrated database retrieval system