KEGG   Isoptericola variabilis: Isova_0886Help
Entry
Isova_0886        CDS       T01520                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
iva  Isoptericola variabilis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isova_0886
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Isova_0886
   00630 Glyoxylate and dicarboxylate metabolism
    Isova_0886
Enzymes [BR:iva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Isova_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(964656..966377)
Genome map
AA seq 573 aa AA seqDB search
MTTLTAPPIFSAPSGTTSDPASRTTGSRRPHGAEGSIDVTGPLGPRYDEILTPEALEFLT
LLHDLFADERCGLLLERQRRTREIADGADPDFTPSTRPVRDDPSWRVAGSVGAPGLEDRR
VEITGPTDPKMTINALNSGARCWLADAEDAQSPTWRNVIEGQLALHDAIRGTLEFTNEAG
KHYALRTSDLTQLPTIIFRPRGWHLFESHLAYTGPDGSTQPASGSLVDFGLYLFHNAREL
IARGRGPYFYLPKLEGYREARLWNQVFEVSEDALGIPRGTIRATVLIETLPAAFEMEEIL
YELREHCAGLNAGRWDYLFSVIKCFRTRGDSYVLPDRGQVTMTAPFMRAYTELLVATCHK
RGAHAIGGMSAFIPDRRDPEVTRRAIEQVRADKTREANDGFDGTWVAHPDLIEVAREAFD
AVLGERPNQVDRLRDDVTVGQAELLDVASARRAGATVTEAGLRTNVSVGVRYIESWLRGV
GAAAIDHLMEDAATAEISRSQVWQWVHAGTTTDDGRPITRRRCEAVLREVMGGLERFRGD
RFDDAAAIFREVALGEEFPPFLTTGAYARYFRQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcaccgcaccccccatcttctccgcaccgtcgggcacgacgtcggacccg
gcgtcgcgcacgaccggcagccggcgcccgcacggcgccgagggctcgatcgacgtcacc
ggccccctgggcccgcggtacgacgagatcctcacgccggaggcgctcgagttcctgacc
ctgctgcacgacctcttcgccgacgagcggtgcgggctcctgctcgagcggcagcgccgc
acgcgcgagatcgccgacggcgccgaccccgacttcaccccgtcgacccggccggtccgg
gacgacccgtcgtggcgcgtcgccggcagcgtcggggcgcccggcctggaggaccgtcgc
gtcgagatcacgggcccgaccgaccccaagatgacgatcaacgcgctcaactcgggcgcc
cggtgctggctcgccgacgccgaggacgcccagtcccccacctggcgcaacgtgatcgag
ggccagctcgcgctgcacgacgcgatccgcggcacgctcgagttcacgaacgaggcgggc
aagcactacgcgctgcgcacgagcgacctcacgcagctgccgacgatcatcttccggccg
cgcggctggcacctgttcgagtcgcacctggcctacacgggcccggacggctcgacgcag
cctgcgtcgggctcgctcgtggacttcggcctctacctgttccacaacgcgcgcgagctg
atcgcccgcgggcgcgggccgtacttctacctgcccaagctcgagggctaccgcgaggcg
cggctgtggaaccaggtgttcgaggtctccgaggacgccctcggcatcccgcgcggcacg
atccgcgccaccgtgctcatcgagacgctgcccgcggcgttcgagatggaggagatcctc
tacgagctgcgcgagcactgcgcgggcctcaacgccgggcgctgggactacctcttctcg
gtcatcaagtgcttccgcacccgcggcgactcgtacgtgctgcccgaccgcggccaggtc
accatgacggccccgttcatgcgcgcgtacaccgagctgctcgtcgccacgtgccacaag
cgcggggcgcacgcgatcggcggcatgagcgcgttcatcccggaccgccgcgacccggag
gtcacgcggcgcgcgatcgagcaggtgcgcgccgacaagacgcgggaggcgaacgacggc
ttcgacggcacgtgggtcgcgcaccccgacctcatcgaggtcgcgcgcgaggccttcgac
gccgtgctcggcgagcgcccgaaccaggtggaccgcctgcgcgacgacgtcacggtcggc
caggcggagctgctcgacgtcgcgtcggcccggcgcgcgggcgcgaccgtgaccgaggcg
gggctgcgcacgaacgtctcggtgggcgtccgctacatcgagtcgtggctgcgcggcgtc
ggcgccgcagcgatcgaccacctcatggaggacgccgcgacggccgagatctcgcggtcg
caggtctggcagtgggtgcacgccggcacgacgacggacgacggccggccgatcacgcgg
cggcgctgcgaggcggtgctgcgcgaggtcatgggcggcctcgagcggttccgcggcgac
cggttcgacgacgccgcggcgatcttccgggaggtcgcgctcggcgaggagttcccgccg
ttcctcacgacgggcgcgtacgcgcggtacttccggcagtga

DBGET integrated database retrieval system