KEGG   Isoptericola variabilis: Isova_0887Help
Entry
Isova_0887        CDS       T01520                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
iva  Isoptericola variabilis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isova_0887
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Isova_0887
Enzymes [BR:iva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Isova_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(966395..967738)
Genome map
AA seq 447 aa AA seqDB search
MTTTLEPQTSPATSGRTSPGTRPGDQTQTAAELAAQWASDPRWAGVRRDYTAEDVVALRG
SVREEHTLARRGAERLWELLHTREYVRALGALTGNQAVQQVKAGLEAIYLSGWQVAADAN
LAGQTYPDQSLYPANSVPQVVRRINNALLRADQIELAESGAPTREWLAPIVADAEAGFGG
PLNAYELMSAMIAAGAAGVHWEDQLASEKKCGHLGGKVLVPTQQHVRTLSAARLAADVAG
VPSVVIARTDALAADLLTSDVDPRDAEFLTGERTPEGFYRVRNGIEPVISRGLAYAEVAD
LLWVETGTPDLDLARRFAEAVHERFPDKLLAYNCSPSFNWKKHLSDAEIASFQRELAAMG
YKFQFITLAGFHSLSHSMFELARGYAERAMSAYVELQEAELASEADGYTATRHQREVGTG
YFDRVATALNPDASTLALAGSTETAQF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccctcgagccccagacctcccccgccacctccggcaggacctcccccggg
acgcgccccggggaccagacgcagacggccgccgagctcgcggcgcagtgggcgtccgac
ccccgctgggccggcgtgcgccgcgactacacggccgaggacgtcgtcgcgctccggggg
tcggtccgcgaggagcacaccctcgcccgccgcggcgccgagcgcctgtgggagctcctg
cacacccgcgagtacgtccgcgccctcggcgccctgacgggcaaccaggccgtgcagcag
gtcaaggccggcctcgaggcgatctacctgtccggctggcaggtggccgccgacgccaac
ctcgcgggccagacctaccccgaccagtcgctctacccggcgaactccgtgccgcaggtc
gtgcgccgcatcaacaacgcgctgctgcgcgccgaccagatcgagctcgccgagtccggc
gctccgacccgtgagtggctcgccccgatcgtggccgacgccgaggccggcttcggcggt
ccgctcaacgcctacgagctcatgagcgcgatgatcgccgcgggcgccgcgggcgtgcac
tgggaggaccagctcgcctcggagaagaagtgcggccacctcggcggcaaggtgctcgtg
ccgacgcagcagcacgtgcgcacgctgagcgccgcacgcctcgcggccgacgtcgcgggc
gtgccgagcgtggtcatcgcccgcaccgacgcgctcgccgccgacctgctgacgtccgac
gtcgacccgcgggacgccgagttcctcaccggcgagcgcacgcccgagggcttctaccgc
gtccgcaacggcatcgagcccgtgatctcccgcggcctcgcctacgccgaggtggccgac
ctgctctgggtcgagaccggcacgcccgacctcgacctcgcgcgccgcttcgccgaggcg
gtccacgagcgcttcccggacaagctgctcgcgtacaactgctcgccctcgttcaactgg
aagaagcacctgtccgacgccgagatcgcctcgttccagcgcgagctcgcggccatgggc
tacaagttccagttcatcaccctcgccgggttccactccctgtcgcactcgatgttcgag
ctcgcgcggggctacgccgagcgcgccatgagcgcctacgtcgagctgcaggaggccgag
ctcgcctccgaggccgacggctacaccgccacccgccaccagcgggaggtcggcacgggc
tacttcgaccgggtcgcgacggcgctcaaccccgacgcctcgaccctcgccctcgccggc
tccaccgagaccgcccagttctga

DBGET integrated database retrieval system