KEGG   Isoptericola variabilis: Isova_0887Help
Entry
Isova_0887        CDS       T01520                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
iva  Isoptericola variabilis
Pathway
iva00630  Glyoxylate and dicarboxylate metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
iva01200  Carbon metabolism
Module
iva_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Isova_0887
Enzymes [BR:iva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Isova_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: AEG43671
JGI: Isova_0887
UniProt: F6FPF8
Position
complement(966395..967738)
Genome map
AA seq 447 aa AA seqDB search
MTTTLEPQTSPATSGRTSPGTRPGDQTQTAAELAAQWASDPRWAGVRRDYTAEDVVALRG
SVREEHTLARRGAERLWELLHTREYVRALGALTGNQAVQQVKAGLEAIYLSGWQVAADAN
LAGQTYPDQSLYPANSVPQVVRRINNALLRADQIELAESGAPTREWLAPIVADAEAGFGG
PLNAYELMSAMIAAGAAGVHWEDQLASEKKCGHLGGKVLVPTQQHVRTLSAARLAADVAG
VPSVVIARTDALAADLLTSDVDPRDAEFLTGERTPEGFYRVRNGIEPVISRGLAYAEVAD
LLWVETGTPDLDLARRFAEAVHERFPDKLLAYNCSPSFNWKKHLSDAEIASFQRELAAMG
YKFQFITLAGFHSLSHSMFELARGYAERAMSAYVELQEAELASEADGYTATRHQREVGTG
YFDRVATALNPDASTLALAGSTETAQF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccctcgagccccagacctcccccgccacctccggcaggacctcccccggg
acgcgccccggggaccagacgcagacggccgccgagctcgcggcgcagtgggcgtccgac
ccccgctgggccggcgtgcgccgcgactacacggccgaggacgtcgtcgcgctccggggg
tcggtccgcgaggagcacaccctcgcccgccgcggcgccgagcgcctgtgggagctcctg
cacacccgcgagtacgtccgcgccctcggcgccctgacgggcaaccaggccgtgcagcag
gtcaaggccggcctcgaggcgatctacctgtccggctggcaggtggccgccgacgccaac
ctcgcgggccagacctaccccgaccagtcgctctacccggcgaactccgtgccgcaggtc
gtgcgccgcatcaacaacgcgctgctgcgcgccgaccagatcgagctcgccgagtccggc
gctccgacccgtgagtggctcgccccgatcgtggccgacgccgaggccggcttcggcggt
ccgctcaacgcctacgagctcatgagcgcgatgatcgccgcgggcgccgcgggcgtgcac
tgggaggaccagctcgcctcggagaagaagtgcggccacctcggcggcaaggtgctcgtg
ccgacgcagcagcacgtgcgcacgctgagcgccgcacgcctcgcggccgacgtcgcgggc
gtgccgagcgtggtcatcgcccgcaccgacgcgctcgccgccgacctgctgacgtccgac
gtcgacccgcgggacgccgagttcctcaccggcgagcgcacgcccgagggcttctaccgc
gtccgcaacggcatcgagcccgtgatctcccgcggcctcgcctacgccgaggtggccgac
ctgctctgggtcgagaccggcacgcccgacctcgacctcgcgcgccgcttcgccgaggcg
gtccacgagcgcttcccggacaagctgctcgcgtacaactgctcgccctcgttcaactgg
aagaagcacctgtccgacgccgagatcgcctcgttccagcgcgagctcgcggccatgggc
tacaagttccagttcatcaccctcgccgggttccactccctgtcgcactcgatgttcgag
ctcgcgcggggctacgccgagcgcgccatgagcgcctacgtcgagctgcaggaggccgag
ctcgcctccgaggccgacggctacaccgccacccgccaccagcgggaggtcggcacgggc
tacttcgaccgggtcgcgacggcgctcaaccccgacgcctcgaccctcgccctcgccggc
tccaccgagaccgcccagttctga

DBGET integrated database retrieval system