KEGG   Isoptericola variabilis: Isova_0896Help
Entry
Isova_0896        CDS       T01520                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
iva  Isoptericola variabilis
Pathway
iva00072  Synthesis and degradation of ketone bodies
iva00650  Butanoate metabolism
iva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Isova_0896
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Isova_0896
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Isova_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR NAD_binding_10 AdoHcyase_NAD Sacchrp_dh_NADP TrkA_N
Motif
Other DBs
NCBI-ProteinID: AEG43680
JGI: Isova_0896
UniProt: F6FPG7
Position
complement(975746..976498)
Genome map
AA seq 250 aa AA seqDB search
MTARPLAGRRALVTGGASGIGAACARELAARGAHVTVADVDPDGAKRLADELGGDAWVVD
LADTRALDDLRLDVDVLVNNAGVQRVSPVEELAPDDFRLLHRLMLEAPFLLVRAALPHMY
ARGWGRIVNISSVHGLVASPFKSAYVSAKHGLEGLSKTVALEGGPHGVTSVCVSPGYVRT
PLVERQIADQARVHGIDESEVVERVLLAESAVKRLVEPEEVASLVGWLTGPEAAMVTGAS
WTVDGGWSAR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcacggcccctcgcaggacgccgggcgctcgtcacgggcggcgcgagcgggatc
ggggcggcctgcgcccgcgagctcgccgcccgtggcgcgcacgtcaccgtggccgacgtc
gaccccgacggcgcgaagcggctcgccgacgagctcggcggcgacgcgtgggtcgtggac
ctcgccgacacgcgtgccctcgacgacctgcggctcgacgtcgacgtcctcgtcaacaac
gccggcgtgcagcgtgtgagcccggtcgaggagctcgcccccgacgacttccggctcctg
caccggctcatgctcgaggccccgttcctgctcgtgcgcgcggcgctgccccacatgtac
gcgcgcgggtggggccgcatcgtcaacatctcgagcgtccacggcctcgtggcgtcgccg
ttcaagtcggcgtacgtctcggccaagcacgggctcgagggcctgtcgaagacggtcgcg
ctcgagggcggcccgcacggcgtgacgagcgtgtgcgtcagccccgggtacgtgcgcacc
ccgctcgtcgagaggcagatcgccgaccaggcccgcgtgcacggcatcgacgagtccgag
gtcgtcgagcgcgtgctgctcgccgagtcggccgtgaagcggctcgtcgagcccgaggag
gtcgcctcgctcgtcgggtggctcaccggtccggaggccgcgatggtcaccggcgcgtcg
tggaccgtcgacggcgggtggagcgcgaggtga

DBGET integrated database retrieval system