KEGG   Isoptericola variabilis: Isova_0960Help
Entry
Isova_0960        CDS       T01520                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic anchor subunit-like protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
iva  Isoptericola variabilis
Pathway
iva00020  Citrate cycle (TCA cycle)
iva00190  Oxidative phosphorylation
iva00650  Butanoate metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
iva01130  Biosynthesis of antibiotics
iva01200  Carbon metabolism
Module
iva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
iva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
iva_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isova_0960
   00650 Butanoate metabolism
    Isova_0960
  Energy metabolism
   00190 Oxidative phosphorylation
    Isova_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS SLC3A2_N
Motif
Other DBs
NCBI-ProteinID: AEG43744
JGI: Isova_0960
UniProt: F6FPV5
Position
complement(1050222..1050686)
Genome map
AA seq 154 aa AA seqDB search
MAATQTTGGIASPRSPYARRTTTRGNYELYSWVFMRASGVLLLVLIFGHLFVNLMVGEGV
KAIDFAFVGGKWSSPFWQVWDLLMLWLAMFHGTNGVRTIINDYAQRDATRGILKALLYLA
FTVVVVLGTLVIFTFDPCPANAPADLLPSICSAS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacgcagaccaccgggggcatcgcgtcgccccgctccccctacgcccgccgg
acgacgacgcggggcaactacgagctgtacagctgggtcttcatgcgggcctcgggtgtg
ctgctgctcgtcctcatcttcgggcacctgttcgtcaacctcatggtgggcgagggcgtc
aaggccatcgacttcgcgttcgtcggcggcaagtggtcgagcccgttctggcaggtctgg
gacctgctcatgctgtggctcgcgatgttccacggcacgaacggcgtccgcacgatcatc
aacgactacgcgcagcgggacgcgacgcgggggattctcaaggcgctgctctacctggcc
ttcacggtcgtcgtggtcctcggcacactggtcatcttcacgttcgacccgtgccccgcg
aacgcgcccgccgacctcctgccgtcgatctgctccgcgagctaa

DBGET integrated database retrieval system