KEGG   Isoptericola variabilis: Isova_0960Help
Entry
Isova_0960        CDS       T01520                                 

Definition
succinate dehydrogenase hydrophobic anchor subunit-like protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
iva  Isoptericola variabilis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isova_0960
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isova_0960
   00650 Butanoate metabolism
    Isova_0960
  Energy metabolism
   00190 Oxidative phosphorylation
    Isova_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1050222..1050686)
Genome map
AA seq 154 aa AA seqDB search
MAATQTTGGIASPRSPYARRTTTRGNYELYSWVFMRASGVLLLVLIFGHLFVNLMVGEGV
KAIDFAFVGGKWSSPFWQVWDLLMLWLAMFHGTNGVRTIINDYAQRDATRGILKALLYLA
FTVVVVLGTLVIFTFDPCPANAPADLLPSICSAS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacgcagaccaccgggggcatcgcgtcgccccgctccccctacgcccgccgg
acgacgacgcggggcaactacgagctgtacagctgggtcttcatgcgggcctcgggtgtg
ctgctgctcgtcctcatcttcgggcacctgttcgtcaacctcatggtgggcgagggcgtc
aaggccatcgacttcgcgttcgtcggcggcaagtggtcgagcccgttctggcaggtctgg
gacctgctcatgctgtggctcgcgatgttccacggcacgaacggcgtccgcacgatcatc
aacgactacgcgcagcgggacgcgacgcgggggattctcaaggcgctgctctacctggcc
ttcacggtcgtcgtggtcctcggcacactggtcatcttcacgttcgacccgtgccccgcg
aacgcgcccgccgacctcctgccgtcgatctgctccgcgagctaa

DBGET integrated database retrieval system