KEGG   Isoptericola variabilis: Isova_0969Help
Entry
Isova_0969        CDS       T01520                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
iva  Isoptericola variabilis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:iva00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1059574..1060884
Genome map
AA seq 436 aa AA seqDB search
MNDRSVAEPFDAVDVIRTKRDRHRLSDAQIDWVIDAYTRGVVAEEQMSALAMAILLNGMS
RAEISRWTAAMIASGERMDFSSLSRPTADKHSTGGVGDKITLPLAPLVATFGVAVPQLSG
RGLGHTGGTLDKLESIPGWRASLSNAEVLAQLEDVGAVICAAGAGLAPADKKLYALRDVT
GTVEAIPLIASSIMSKKIAEGTGALVLDVKVGSGAFMKDVDQARELARTMVDLGTDAGVR
TVALLTDMEVPLGRTAGNALEVRESLDVLAGGGPRDVVDLTVALAVEMLAAADRPTGEDE
VRRALADGRAMDTWRRMIAAQGGDPDAELPVARETEHVVADRTGVLAELDAYAVGVAAWR
LGAGRGRREDPVQAGAGVEIHAKPGDQVVAGQTLLTLHTDTPERFDRARDALEGAWSVAP
AGTAVPTRPLVLDRIR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgttccgtggccgagccgttcgacgccgtcgacgtcatccgcaccaagcgc
gaccggcaccgcctgtccgacgcccagatcgactgggtgatcgacgcctacacccgcggc
gtggtggccgaggagcagatgtcggcgctcgccatggcgatcctgctcaacgggatgagc
cgcgccgagatctcgcggtggaccgcggccatgatcgcctcgggcgagcgcatggacttc
tcgtcgctgtcgcgccccacggccgacaagcactcgacggggggagtgggcgacaagatc
acgctcccgctcgcgccgctcgtcgcgaccttcggggtggctgtgccgcagctgtcgggc
cgcgggctcgggcacacgggcggcacgctcgacaagctcgagtcgatcccgggctggcgc
gcgtcgctgagcaacgccgaggtcctcgcccagctcgaggacgtcggcgcggtgatctgc
gccgccggggcggggctcgcgcccgccgacaagaagctctacgcgctgcgcgacgtcacc
gggacggtcgaggcgatcccgctcatcgcgagttcgatcatgagcaagaagatcgccgag
ggcacgggcgcgctcgtgctcgacgtcaaggtcggctcgggcgcgttcatgaaggacgtg
gaccaggcgcgcgagctcgcccgcaccatggtcgacctgggcacggacgcgggcgtgcgc
acggtcgccctgctcacggacatggaggtgccgctcgggcgcaccgcgggcaacgcgctc
gaggtccgcgagtcgctcgacgtgctcgccggcggcggaccgcgcgacgtcgtcgacctc
acggtcgcgctcgcggtcgagatgctcgccgccgccgaccggcccaccggggaggacgag
gtgcgccgggcgctggccgacgggcgggcgatggacacgtggcgccgcatgatcgcggcg
cagggcggcgaccccgacgccgagctgcccgtcgcgcgcgagaccgagcacgtggtggcc
gaccgcacgggcgtgctcgccgagctcgacgcgtacgccgtgggcgtcgcggcgtggcgc
ctcggcgccggccgcggacgccgcgaggacccggtccaggccggggccggcgtcgagatc
cacgccaagcccggggaccaggtcgtcgcgggccagacgctgctcacgctgcacaccgac
acgcccgagcggttcgaccgcgcgcgcgacgcgctcgagggcgcgtggagcgtcgccccg
gcggggaccgccgtgccgacgcggccgctggtgctcgaccggatccgctga

DBGET integrated database retrieval system