KEGG   Isoptericola variabilis: Isova_1065Help
Entry
Isova_1065        CDS       T01520                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
iva  Isoptericola variabilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Isova_1065
Enzymes [BR:iva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Isova_1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1154032..1156242
Genome map
AA seq 736 aa AA seqDB search
MGALPVPGFDGRIVPVSDDLITGDDVPAELLELAAAHGVLTEHHTFAGGTERVRASTLVA
VLEALGVPAATPQQITHSLQRARDEEWRSVLPPTVVVRQGEETRVPVHVTDGASVHVWTE
VDGAEPTARLSQHRPRRDLEQVDAFVEPRTVDGRRVGRATFVVPADLPLGWHSLHALSEG
HETRATLVVTPRRLELPPAVAEGQVWGFLVQLYSVRSRTSWGLGDLADLADLAWLTAHRA
KGDFVAVNPLAAAEPVTPMTPSPYLPTSRRFLNPVYVRVEDIPETAYLSAADRSLVEWAA
DPVRELTEDPGPIDRDAVWEAKKAALDVVFTAPRRAARQAAYEEFVEEQGKGLRDFATWC
AIAEHLAGKEWPRELSDPGSAAVAALREELAERVEFYCWLQWVADEQKHTAQRVAREAGM
AVGIMHDLPVGVHPEGADAWAHQDVLARGVSVGAPPDMYNQQGQNWSQPPWNPRALARAG
YVPYRDMLRTVLRHAGALRVDHILGLFRLWWVPGGAKASEGAYVRYDHEALVGILCLEAH
RAGAIVVGEDLGVYEPWVRDYLADRGILGTSVLWFEKDDDGRPLPPEKYRRMTLASVGTH
DMPPTAGYLAGEHVDLRERLGLLTEDPQVLRQRARLERDTAVRTLAERGLVGDDPSEREI
VEALHRYLRRSRAAMVGVQLVDAVGERRSQNQPGTDQEYPNWKVPLGDAAGNVVLVEDLF
DNARLRSLVQALNTAR
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcactgcccgtgcccgggttcgatggcaggatcgtccccgtgagcgacgacctg
atcaccggcgacgacgtgcccgccgagctgctcgagctcgccgctgcgcacggggtcctc
accgagcaccacacgttcgcgggcgggaccgagcgcgtccgcgcgtcgacgctcgtggcg
gtcctcgaggccctcggcgtcccggccgcgaccccccagcagatcacgcacagcctccag
cgcgcccgcgacgaggagtggcgctcggtgctgccgccgaccgtcgtcgtgcgtcagggc
gaggagacgcgggtgccggtgcacgtgactgacggcgcgtccgtgcacgtgtggaccgag
gtcgacggcgccgagccgaccgcccggctgtcccagcaccggccgcgccgcgacctcgag
caggtcgacgccttcgtcgagccccgtacggtcgacgggcggcgcgtgggccgcgcgacc
ttcgtggtgccggccgacctgccgctcggctggcactcgctgcacgcgctgagcgagggg
cacgagacgcgcgcgacgctcgtcgtgacgccgcgccggctcgagctgccgcccgcggtc
gccgaggggcaggtgtggggcttcctcgtgcagctgtactccgtgcgctcgcgcacctcg
tgggggctcggcgacctggccgacctggccgacctcgcgtggctcacggcgcaccgggcc
aagggcgacttcgtcgcggtcaacccgctggccgcggccgagcccgtcacgcccatgacg
ccgtcgccgtacctgccgacgagccggcgcttcctcaaccccgtgtacgtgcgggtcgag
gacatccccgagacggcgtacctgtcggcggccgaccgctcgctcgtcgagtgggccgcg
gacccggtgcgcgagctcaccgaggacccgggccccatcgaccgcgacgccgtgtgggag
gccaagaaggccgcgctcgacgtcgtgttcaccgcgccccgccgcgcggcccggcaggcg
gcgtacgaggagttcgtcgaggagcagggcaagggcctgcgggacttcgcgacctggtgc
gcgatcgccgagcacctcgccggcaaggagtggccgcgcgagctgtccgacccgggctcg
gccgccgtcgcggcgctgcgcgaggagctggccgagcgcgtcgagttctactgctggctg
cagtgggtcgccgacgagcagaagcacacggcgcagcgcgtcgcccgcgaggcgggcatg
gcggtcgggatcatgcacgacctcccggtcggggtgcaccccgagggcgccgacgcgtgg
gcgcaccaggacgtgctcgcgcgcggcgtgtccgtcggcgcgccgcccgacatgtacaac
cagcagggtcagaactggtcgcagccgccgtggaacccgcgcgcgctggcccgggccggc
tacgtcccgtaccgggacatgctgcgcacggtgctgcgccacgcgggcgcgctgcgggtc
gaccacatcctcggcctgttccggctgtggtgggtgcccggcggcgccaaggcgtccgag
ggcgcgtacgtgcgctacgaccacgaggccctcgtcggcatcctgtgcctcgaggcgcac
cgggctggcgcgatcgtcgtcggcgaggacctcggcgtctacgagccgtgggtgcgggac
tacctcgccgaccgcgggatcctcggcacctcggtgctgtggttcgagaaggacgacgac
ggccgcccgctcccgccggagaagtaccgccgcatgaccctcgcgtcggtcggcacgcac
gacatgccgcccaccgccgggtacctggccggcgagcacgtcgacctgcgcgagcggctc
ggcctgctcaccgaggacccgcaggtgctgcggcagcgggcgcggctcgagcgcgacacc
gccgtgcggacgctcgccgagcgcgggctcgtcggcgacgacccgtccgagcgcgagatc
gtcgaggcgctgcaccggtacctgcggcgctcccgcgccgccatggtcggcgtccagctc
gtcgacgccgtgggggagcggcgctcgcagaaccagcccggcaccgaccaggagtacccg
aactggaaggtgcccctcggcgacgcggccggcaacgtcgtgctcgtcgaggacctcttc
gacaacgcccgcctgcgctcgctggtccaggccctcaacactgcgaggtag

DBGET integrated database retrieval system