KEGG   Isoptericola variabilis: Isova_1102Help
Entry
Isova_1102        CDS       T01520                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
iva  Isoptericola variabilis
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Isova_1102
Enzymes [BR:iva01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Isova_1102
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Isova_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1193484..1194335
Genome map
AA seq 283 aa AA seqDB search
MVHDGGARVLQDARLEVWAPPGLGEVRPGDDLAALVGDLLDGAVLDGEALAEGDVVVVTS
KVVSKAEGRVVRATDREQAITDETVRVVATRERPGGLPPLRIVENRLGLVMAAAGVDASN
TPEGTVLLLPVDPDASARRLRAAWRERFGLDRLGVVVTDTAGRPWREGLTDIAIGAAGVA
VVDDLRGGADAHGRPLNVTVTAVADEIAAASELVRGKASGRAIAVVRGVGRFVLGGDGPA
GDGPGARTLVRPSADDLFREGSAEAYARGYAAARAEVAHDPAR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacgacggcggtgcgcgcgtcctgcaggacgcgcgcctcgaggtgtgggccccg
ccggggctgggggaggtgcggccgggcgacgacctcgccgccctcgtcggcgacctgctc
gacggcgcggtgctcgacggcgaggcgctcgcggagggcgacgtcgtcgtcgtgacgtcg
aaggtcgtgtccaaggccgaggggcgtgtggtccgggccaccgaccgcgagcaggccatc
accgacgagaccgtgcgcgtcgtcgccacgcgcgagcggcccggcgggctgccgccgctg
cggatcgtcgagaaccggctcgggctcgtcatggccgccgctggcgtcgacgcctccaac
acgcccgagggcacggtgctgctgcttccggtcgaccccgatgcgtccgcgcggcgcctg
cgggcggcgtggcgtgagcggttcgggctcgaccggctcggcgtcgtcgtcacggacacc
gcgggccggccgtggcgcgaggggctcaccgacatcgcgatcggtgcggccggggtggcg
gtcgtcgacgacctgcgcgggggagcggacgcgcacggccggcccctgaacgtcaccgtg
accgcggtggccgacgagatcgccgccgcgtccgagctcgtgcgcggcaaggcgagcggg
cgcgccatcgccgtcgtccgtggcgtcggccgcttcgtgctgggcggcgacggcccggcg
ggtgacgggcccggggcacgcaccctcgtgcggccgagcgccgacgacctcttccgtgag
ggctccgccgaggcctacgcccgcggctacgccgccgcccgcgccgaggtagcgcacgat
ccggcgaggtag

DBGET integrated database retrieval system