KEGG   Isoptericola variabilis: Isova_1110Help
Entry
Isova_1110        CDS       T01520                                 

Definition
Alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
iva  Isoptericola variabilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Isova_1110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isova_1110
  Lipid metabolism
   00071 Fatty acid degradation
    Isova_1110
  Amino acid metabolism
   00350 Tyrosine metabolism
    Isova_1110
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Isova_1110
   00626 Naphthalene degradation
    Isova_1110
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Isova_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1201398..1202435)
Genome map
AA seq 345 aa AA seqDB search
MVYDSFGGPVTVREVPDPVAPDGGAVVRVHASGLCLSDWHGWAGHDPDIDALPHVPGHEL
AGVVEAVGTGVRRWRVGDRVTVPFVCGCGACAWCAAGQAQVCPNQTQPGFTHRGSDAELV
ALHAADTNLVAVPDGVTDAEAASLGCRFATAYRAVTARARVQAGEWVVVIGAGGVGLSAV
MVAAALGARVVAVDRHSAALEAARAAGASHVVHTRPDVDVADQVHDLTDGGAHVAIDAVG
SEQTCADGILSLRRQGRHVQVGLLPPVEGHPRVPMSRVIGWELDVLGSHGMAAADYPEML
ALVADGTLRPQELVGRVVGLEEGARLLPGLHDAPRAGMVVVDPRR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtctacgactccttcggcggtcccgtcacggtccgtgaggtgcccgacccggtcgcg
cccgacggcggtgcggtcgtccgggtgcacgcgtccggcctgtgcctgagcgactggcac
gggtgggccggccacgaccccgacatcgacgcgctgccgcacgtgcccgggcacgagctg
gccggcgtggtcgaggcggtcgggacgggcgtgcggcggtggcgggtcggcgaccgcgtg
accgtgccgttcgtctgcggctgcggcgcgtgcgcgtggtgcgccgccgggcaggcgcag
gtctgcccgaaccagacgcagcccggcttcacgcaccggggctccgacgccgagctcgtc
gcgctgcacgccgcggacacgaacctcgtcgccgtgcccgacggcgtcaccgacgccgag
gccgcgagcctcggctgccgcttcgccaccgcctaccgggccgtgaccgcccgggcacgc
gtgcaggccggcgagtgggtcgtcgtgatcggcgcgggcggcgtcgggctcagcgccgtc
atggtggcggccgcgctcggggcgcgcgtcgtcgccgtcgaccggcattcggcagcgttg
gaggcggctcgggcggcgggcgcgtcgcacgtcgtgcacacccggcccgacgtcgacgtc
gccgaccaggtgcacgacctgaccgacggcggcgcgcacgtggcgatcgacgccgtcggg
tccgagcagacgtgcgccgacggcatcctcagcctgcgccggcagggccggcacgtgcag
gtggggctgctgccgccggtcgagggccacccgcgcgtgcccatgagccgcgtcatcggc
tgggagctcgacgtgctcggcagccacggcatggccgccgccgactaccccgagatgctc
gcgctcgtcgccgacggcacgctgcggccgcaggagctggtgggccgcgtggtcgggctc
gaggagggggcgcggctgctgcccggcctgcacgacgccccgcgcgcgggcatggtcgtc
gtcgacccgcgccgctga

DBGET integrated database retrieval system