KEGG   Isoptericola variabilis: Isova_1213Help
Entry
Isova_1213        CDS       T01520                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
iva  Isoptericola variabilis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:iva03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1326016..1326918)
Genome map
AA seq 300 aa AA seqDB search
MPELPEVESLARFLDGRTAGRTVVAVDVAAIAALKTFDPPATALVGGRVAGAGRHGKWLD
VAVTPAAGSGGDALHLVFHLARGGWLRWRDQAPTTPVAPRLGGSSRGAALALRVRFDDGS
GFDLTEAGTRKRLAVHVVRDPQEVEQVRTLGIEPLSEDFTADALAALLTRKNQQVKGLLR
DQSAIAGIGNAYSDEILHVARFSPFKLTRSFTPEEVATLHEATVTTLRDAVAASAGRPAA
ELKDAKRRGMRVHGRTGEACPVCGDTVREVSFADRSLQYCPTCQTGGQVLADRRLSRLLK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgcccgaggtcgagtcgctggcccgcttcctcgacgggcgcacggccggt
cgcacggtcgtcgccgtcgacgtcgcggcgatcgccgcgctcaagacgttcgacccgccc
gcgaccgcgctcgtcggcggccgcgtcgccggcgccggccggcacggcaagtggctcgac
gtcgccgtgacgcccgctgccgggtccggcggcgacgcgctgcacctggtcttccacctc
gcgcggggcgggtggctgcgctggcgcgaccaggcgccgacgacgccggtcgcgccgcgc
ctcggcgggtcctcgcgcggtgcggcgctcgcgctgcgcgtccggttcgacgacggctcg
ggcttcgacctcacggaggccggcacgcgcaagcgcctcgccgtgcacgtggtgcgcgac
ccgcaggaggtcgagcaggtgcgcacgctcggcatcgagccgctctcggaggacttcacg
gccgacgcgctggccgcgctgctcacccgcaagaaccagcaggtcaagggcctgctgcgc
gaccagtccgcgatcgcgggcatcggcaacgcctactccgacgagatcctgcacgtcgcc
cggttcagccccttcaagctcacccgctcgttcacgcccgaggaggtcgccacgctgcac
gaggccacggtgacgacgctgcgcgacgccgtcgcggcgtcggcgggccggcccgcggcc
gagctcaaggacgccaagcgccgcggcatgcgcgtgcacgggcgcacgggcgaggcgtgc
ccggtgtgcggcgacacggtgcgcgaggtgagcttcgccgaccggtcgctgcagtactgc
ccgacgtgccagacgggcgggcaggtcctcgccgaccggcgcctgtcccgcctgctcaag
taa

DBGET integrated database retrieval system