KEGG   Isoptericola variabilis: Isova_1439Help
Entry
Isova_1439        CDS       T01520                                 

Definition
PfkB domain-containing protein
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
iva  Isoptericola variabilis
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Isova_1439
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Isova_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1562701..1563636)
Genome map
AA seq 311 aa AA seqDB search
MNRESSPALCVLTPDPLLTVEIEGDRAGGAPEIHVHPGGQGLWVAKMAESLGARVVVCGP
FGGETGELTAHLARTDNLELRPTAHGGGAVVVQDRRSGEAEEIAVMPPEPLDRHALDDLY
SMALVTALDADVCVLTGTQFDLGVPADLFGRLARDLAASGRAVVADLSGDAARAVAQEAA
TVLKISHEELVEGGFAKDDSVGALRAAATEMIDGGPGAVVVSRADEPTLLVTADATWTVT
TPPVTTVDHRGAGDSMTAGIAVGVGRGLELPDAVSLGAAAGALNVARHGLGTGRRDQIES
FARRVTVETLD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgagagtcgtcccccgcgctctgcgtgctcacgccggacccgctgctcacggtc
gagatcgagggcgaccgcgccggcggcgcgccggagatccacgtgcaccccggcggccag
gggctctgggtcgcgaagatggccgagtcgctgggcgcgcgcgtcgtggtctgcggtccg
ttcggcggcgagaccggcgagctcacggctcacctggcccgcaccgacaacctggagctg
cgcccgacggcgcacggcggcggcgcggtcgtggtccaggaccggcgctcgggcgaggcg
gaggagatcgccgtcatgccgcccgagccgctcgaccggcacgcgctcgacgacctgtac
agcatggcgctcgtcaccgcgctcgacgcggacgtgtgcgtgctgacgggcacccagttc
gacctcggcgtcccggcggacctcttcggccgcctcgcccgggacctggccgcctcgggc
cgggcggtcgtcgcggacctgtcgggcgacgcggcccgggcggtcgcccaggaggcggcg
accgtgctgaagatcagccacgaggagctggtcgagggcgggttcgcgaaggacgactcg
gtgggtgcgctgcgggccgcggcgaccgagatgatcgacggcggccccggggcggtcgtc
gtctcgcgcgccgacgagccgaccctgctcgtcacggcggacgccacgtggacggtcacg
acgccgcccgtcaccacggtcgaccaccggggcgcgggcgactccatgacggcgggcatc
gcggtcggggtcgggcgcggcctcgagctgcccgacgcggtgagcctcggcgcggcggcc
ggcgccctgaacgtggcgcggcacggcctcggcacggggcggcgcgaccagatcgagagc
ttcgcgcggcgggtgaccgtcgagaccctggactga

DBGET integrated database retrieval system