KEGG   Isoptericola variabilis: Isova_1460Help
Entry
Isova_1460        CDS       T01520                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
iva  Isoptericola variabilis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:iva01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:iva00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1585194..1586018
Genome map
AA seq 274 aa AA seqDB search
MTVLEDIVAGVREDLAVRQARTSLDELKERAARVPGALECCSRLLSEDRVAVIAEVKRSS
PSKGALAPITDPAALAVEYAQGGASAISVLTEERRFRGSLADLDAVRARVDVPVLRKDFV
VTPYQVWEARAHGADLVLLIVAALEQTVLTSLVERVHSLGMTALVEAHTVEEVHRALDAG
ARIVGVNARDLKTLEVDRSTFARLAPHIPDDVVRVAESGVRGPHDVMEYARAGAHAVLVG
EALVTDAAPRQSVADLVAAGQHPALWSVRPAAQP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcctggaggacatcgtcgcgggggtccgcgaggacctcgccgtgcgccaggcg
cgcacctcgctcgacgagctcaaggagcgcgccgcccgcgtgcccggggcgctcgagtgc
tgcagccggctgctgtccgaggaccgcgtcgccgtgatcgccgaggtcaagcgctcgagc
ccgagcaagggcgcgctcgccccgatcacggaccccgcggcgctcgcggtcgagtacgcc
cagggcggcgcgagcgcgatctccgtcctcacggaggagcgccggttccgcggcagcctg
gcggacctcgacgccgtgcgcgcccgggtcgacgtgccggtgctgcgcaaggacttcgtc
gtcaccccgtaccaggtgtgggaggcccgcgcccacggcgcggacctcgtcctgctcatc
gtcgccgcgctcgagcagaccgtgctgacgtcgctcgtcgagcgcgtgcactcgctcggc
atgacggcgctcgtcgaggcccacacggtcgaggaggtgcaccgcgcgctcgacgccggt
gcccggatcgtcggcgtcaacgcgcgcgacctcaagacgctcgaggtcgaccgcagcacc
ttcgcgcgcctcgccccgcacatccccgacgacgtcgtgcgcgtcgccgagtccggcgtg
cgcgggccgcacgacgtcatggagtacgcgcgcgccggcgcgcacgccgtcctcgtgggg
gaggcgctcgtgaccgacgccgcgccccggcagtccgtggcggacctggtcgccgccggg
cagcacccggccctgtggtcggtgcgccccgcggcccagccgtga

DBGET integrated database retrieval system