KEGG   Isoptericola variabilis: Isova_1461Help
Entry
Isova_1461        CDS       T01520                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
iva  Isoptericola variabilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isova_1461
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isova_1461
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Isova_1461
Enzymes [BR:iva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Isova_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1586054..1587388
Genome map
AA seq 444 aa AA seqDB search
MPSSEPVRDALTETLAHQVLGRLADQPGPYFGEFGGRFVPEALISALDELETEYRKALGD
PVFRDELARLHREYTGRPSPLTEVPRFAEHAGGAPGDVRILLKREDLNHTGSHKINNVLG
QALLVKRMGKTRVIAETGAGQHGVATATAAALLGLECVVYMGEEDTRRQALNVARMRLLG
AEVVPVTIGTRTLKDAINEALRDWVTNVETTHYLLGTVTGPHPFPEMVREFHRIIGEEAR
EQVLERVGRLPDAVAACVGGGSNALGIFNAFLDDEGVALHGFEAGGEGVETGRHAARFSG
GAPGVLHGARSYLLQDDDGQTLPSHSVSAGLDYPSVGPAHAWLHDMGRATYEPVTDDEAM
EAFRLLCRTEGIIPAIESAHALAGALRVGRAAVAEGRTDLVVLVNLSGRGDKDVATAARW
FGLLDDVGGDEAVVETVTSEEGNL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgccctcgagcgagcccgtgcgcgacgcgctgaccgagaccctggcgcaccaggtgctc
ggccgcctcgccgaccagcccggaccgtacttcggcgagttcggcggtcgcttcgtgccc
gaggccctgatctcggcgctcgacgagctcgagaccgagtaccgcaaggcgctcggcgac
cccgtcttccgcgacgagctcgcgcgcctgcaccgcgagtacaccgggcgcccgtcgccg
ctgaccgaggtgccgcgcttcgccgagcacgcgggcggcgctccgggcgacgtccggatc
ctgctcaagcgcgaggacctcaaccacacgggctcgcacaagatcaacaacgtgctcggc
caggcgctgctcgtcaagcgcatgggcaagacgcgcgtcatcgccgagacgggcgcgggc
cagcacggcgtcgcgaccgcgacggccgccgcgctgctcgggctcgagtgcgtcgtgtac
atgggcgaggaggacacgcgccgacaggccctcaacgtcgcgcgcatgcgcctgctcgga
gccgaggtcgtgcccgtgacgatcggcacgcgcacgctcaaggacgcgatcaacgaggcg
ctgcgcgactgggtcaccaacgtcgagaccacgcactacctgctgggcaccgtcaccggc
ccgcacccgttccccgagatggtgcgcgagttccaccgcatcatcggcgaggaggcgcgc
gagcaggtgctcgagcgcgtcggccggctgcccgacgccgtcgccgcgtgcgtcggcggc
gggtccaacgccctgggcatcttcaacgccttcctcgacgacgagggcgtggccctccac
ggcttcgaggccggcggcgagggcgtcgagaccggccgccacgcggcccgcttctccggc
ggcgcgcccggcgtgctgcacggcgcccggtcgtacctgctgcaggacgacgacgggcag
acgctgccgagccactccgtctcggccggcctcgactacccgagcgtcgggcccgcgcac
gcgtggctccacgacatgggccgcgcgacgtacgagccggtgaccgacgacgaggccatg
gaggcgttccggctcctgtgccgcaccgaggggatcatccccgccatcgagtccgcgcac
gcgctcgccggcgcgctgcgcgtcgggcgcgcggcggtcgccgagggccggaccgacctg
gtggtcctcgtcaacctctcgggccgcggggacaaggacgtggccacggccgcgcgctgg
ttcgggctgctcgacgacgtcggcggggacgaggccgtcgtcgagacggtcacgagcgag
gagggcaacctgtga

DBGET integrated database retrieval system