KEGG   Isoptericola variabilis: Isova_1462Help
Entry
Isova_1462        CDS       T01520                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
iva  Isoptericola variabilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isova_1462
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isova_1462
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Isova_1462
Enzymes [BR:iva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Isova_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1587385..1588236
Genome map
AA seq 283 aa AA seqDB search
MSAPVTTSRTATRLSELRDQGRAALVGYLPVGFPDVPRSVEAALAMVDAGVDVVEVGVPY
TDPVMDGPVIQRAAEAALEGGTRVRDVLTLVEAVARHSGGRVPALVMSYWNPVLRYGVDA
FARDLAAAGGAGLITPDLIPDEAGEWIAASDAHGLDRVFLVAPSSTTERLRLTARASRGF
VYAASTMGVTGARASVGSRAERLVADTRAAGAPHVCVGLGVSTGDQAAEVGRYADGVIVG
SALVRTLLDDAPWPARLDALRRLTGELADGVARARATTPEAVP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccccggtcaccacgtcgcggaccgcgacccgcctgtccgagctgcgcgaccag
ggtcgcgccgcgctcgtcggctacctcccggtcggcttccccgacgtgccgcgctcggtc
gaggccgccctcgcgatggtcgacgccggcgtggacgtcgtcgaggtcggcgtcccctac
accgacccggtcatggacggcccggtcatccagcgggcggccgaggccgcgctggagggc
ggcacccgcgtgcgcgacgtcctcacgctcgtcgaggccgtcgcccggcactcgggcggc
cgcgtgcccgccctcgtgatgagctactggaaccccgtgctgcgctacggcgtcgacgcg
ttcgcgcgcgacctcgccgcggcgggcggtgccgggctcatcaccccggacctcatcccc
gacgaggccggcgagtggatcgcggcctccgacgcgcacggtctcgaccgcgtcttcctc
gtcgcgccgagctcgacgaccgagcgcctgcgcctcaccgcccgcgcgtcgcgcggcttc
gtgtacgccgcgtcgaccatgggcgtcacgggggcgcgcgcgagcgtcggctcgcgcgcc
gagcggctcgtggccgacacgcgcgcggccggcgcgccgcacgtgtgcgtcggcctcggc
gtctccacgggggaccaggccgccgaggtcgggcgctacgcagacggcgtcatcgtcggg
tcggcgctcgtgcgcacgctgctcgacgacgccccgtggccggcccgcctcgacgcgctc
cggcgcctcacgggcgagctcgcggacggcgtcgcgcgcgcccgcgccacgacgcccgag
gccgtcccgtga

DBGET integrated database retrieval system