KEGG   Isoptericola variabilis: Isova_1462Help
Entry
Isova_1462        CDS       T01520                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
iva  Isoptericola variabilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isova_1462
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isova_1462
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Isova_1462
Enzymes [BR:iva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Isova_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1587385..1588236
Genome map
AA seq 283 aa AA seqDB search
MSAPVTTSRTATRLSELRDQGRAALVGYLPVGFPDVPRSVEAALAMVDAGVDVVEVGVPY
TDPVMDGPVIQRAAEAALEGGTRVRDVLTLVEAVARHSGGRVPALVMSYWNPVLRYGVDA
FARDLAAAGGAGLITPDLIPDEAGEWIAASDAHGLDRVFLVAPSSTTERLRLTARASRGF
VYAASTMGVTGARASVGSRAERLVADTRAAGAPHVCVGLGVSTGDQAAEVGRYADGVIVG
SALVRTLLDDAPWPARLDALRRLTGELADGVARARATTPEAVP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccccggtcaccacgtcgcggaccgcgacccgcctgtccgagctgcgcgaccag
ggtcgcgccgcgctcgtcggctacctcccggtcggcttccccgacgtgccgcgctcggtc
gaggccgccctcgcgatggtcgacgccggcgtggacgtcgtcgaggtcggcgtcccctac
accgacccggtcatggacggcccggtcatccagcgggcggccgaggccgcgctggagggc
ggcacccgcgtgcgcgacgtcctcacgctcgtcgaggccgtcgcccggcactcgggcggc
cgcgtgcccgccctcgtgatgagctactggaaccccgtgctgcgctacggcgtcgacgcg
ttcgcgcgcgacctcgccgcggcgggcggtgccgggctcatcaccccggacctcatcccc
gacgaggccggcgagtggatcgcggcctccgacgcgcacggtctcgaccgcgtcttcctc
gtcgcgccgagctcgacgaccgagcgcctgcgcctcaccgcccgcgcgtcgcgcggcttc
gtgtacgccgcgtcgaccatgggcgtcacgggggcgcgcgcgagcgtcggctcgcgcgcc
gagcggctcgtggccgacacgcgcgcggccggcgcgccgcacgtgtgcgtcggcctcggc
gtctccacgggggaccaggccgccgaggtcgggcgctacgcagacggcgtcatcgtcggg
tcggcgctcgtgcgcacgctgctcgacgacgccccgtggccggcccgcctcgacgcgctc
cggcgcctcacgggcgagctcgcggacggcgtcgcgcgcgcccgcgccacgacgcccgag
gccgtcccgtga

DBGET integrated database retrieval system