KEGG   Isoptericola variabilis: Isova_1465Help
Entry
Isova_1465        CDS       T01520                                 

Definition
glutamate synthase (EC:1.4.1.13)
Orthology
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
iva  Isoptericola variabilis
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:iva01230]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:iva00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:iva00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1593909..1595378
Genome map
AA seq 489 aa AA seqDB search
MADPRGFLKVRHRELPPNRPVPVRLRDWKDVRAHLEEGQPFLKEQAGRCMDCGIPFCHQG
CPLGNLIPEWNDLVWRDQWADAIERLHATNNFPEFTGRVCPAPCETSCVLGINQPAVTIK
NVEVSIIDEAFARGLVTPQVPQRLTGSTVAVVGSGPAGLAAAQQLTRAGHTVVVYERDDA
VGGLLRYGIPDFKLEKHHIDRRLAQMEAEGTRFRPGVEIGRDITWDALRRRFDAVVVATG
ATVPRDLALPGRDLGGIHFAMDFLVPANKVVAGRPVPDDVPHAAGKHVVVIGGGDTGSDC
VGTSLRQGAASVTTLAIGKKPPLERPENQPWPTDPILFEVSTSHEEGGERIYLASTVAFL
GDDEGNVRALRVAETEYLPDGRRAPRPGTEREIPADLVLIAMGFTGPETDELVAQTGAET
TGRGLVRRGDDYASSVPGVFVTGDAGRGQSLIVWAIAEGRATAAAVDAYLQGSTELPAPV
GPRTVALRV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacccgcgcgggttcctgaaggtgcggcaccgcgagctgccgcccaaccgtccg
gtgccggtccgcctgcgcgactggaaggacgtccgcgcccacctcgaggagggtcagccg
ttcctcaaggagcaggcgggacgctgcatggactgcggcatcccgttctgccaccagggc
tgcccgctcgggaacctcatcccggagtggaacgacctggtgtggcgcgaccagtgggcc
gacgccatcgagcggctccacgcgaccaacaacttcccggagttcacggggcgcgtgtgc
ccggcgccgtgcgagacgagctgcgtgctgggcatcaaccagcccgcggtgacgatcaag
aacgtcgaggtctcgatcatcgacgaggcgttcgcgcgcggtctggtgaccccgcaggtg
ccgcagcgcctcacgggctcgacggtcgcggtcgtcggctcggggccggcgggcctcgcg
gcggcgcagcagctcacgcgcgccggccacaccgtcgtcgtgtacgagcgcgacgacgcc
gtgggcggcctgctgcggtacggcatcccggacttcaagctcgagaagcaccacatcgac
cgccgtctggcgcagatggaggccgagggcacccgcttccgccctggcgtggagatcggc
cgggacatcacgtgggacgcgctgcgccgccggttcgacgcggtcgtggtcgccacgggc
gccacggtcccgcgcgacctcgcgctgcccggccgcgacctcggcggcatccacttcgcg
atggacttcctggtccccgcgaacaaggtggtcgccggccgcccggtccctgacgacgtc
ccgcacgcggcgggcaagcacgtggtcgtcatcggcggcggcgacaccggctccgactgc
gtcggcacctcgctgcgccagggcgcggcgtcggtcacgacgctcgcgatcggcaagaag
ccgccgctcgagcggcccgagaaccagccgtggccgaccgacccgatcctcttcgaggtc
tcgacctcgcacgaggagggcggcgagcgcatctacctcgcgtcgaccgtggcgttcctc
ggcgacgacgagggcaacgtccgcgcgctgcgcgtggcggagaccgagtaccttcccgac
gggcgccgcgcgccccggccgggcaccgagcgggagatcccggcggacctcgtgctgatc
gcgatgggcttcacgggcccggagacggacgagctggtggcccagaccggtgcggagacg
acgggccgcgggctcgtgcgccgcggcgacgactacgcgtcgagcgtcccgggcgtcttc
gtgaccggcgacgccggtcgcgggcagtcgctcatcgtgtgggcgatcgccgagggccgc
gccaccgcggccgccgtcgacgcttacctgcagggcagcaccgagctgcccgccccggtg
ggcccccgcacggtcgccctgagagtatga

DBGET integrated database retrieval system