KEGG   Isoptericola variabilis: Isova_1465Help
Entry
Isova_1465        CDS       T01520                                 

Definition
glutamate synthase (EC:1.4.1.13)
Orthology
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
iva  Isoptericola variabilis
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isova_1465
  Energy metabolism
   00910 Nitrogen metabolism
    Isova_1465
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Isova_1465
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Isova_1465
    1.4.1.14  glutamate synthase (NADH)
     Isova_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1593909..1595378
Genome map
AA seq 489 aa AA seqDB search
MADPRGFLKVRHRELPPNRPVPVRLRDWKDVRAHLEEGQPFLKEQAGRCMDCGIPFCHQG
CPLGNLIPEWNDLVWRDQWADAIERLHATNNFPEFTGRVCPAPCETSCVLGINQPAVTIK
NVEVSIIDEAFARGLVTPQVPQRLTGSTVAVVGSGPAGLAAAQQLTRAGHTVVVYERDDA
VGGLLRYGIPDFKLEKHHIDRRLAQMEAEGTRFRPGVEIGRDITWDALRRRFDAVVVATG
ATVPRDLALPGRDLGGIHFAMDFLVPANKVVAGRPVPDDVPHAAGKHVVVIGGGDTGSDC
VGTSLRQGAASVTTLAIGKKPPLERPENQPWPTDPILFEVSTSHEEGGERIYLASTVAFL
GDDEGNVRALRVAETEYLPDGRRAPRPGTEREIPADLVLIAMGFTGPETDELVAQTGAET
TGRGLVRRGDDYASSVPGVFVTGDAGRGQSLIVWAIAEGRATAAAVDAYLQGSTELPAPV
GPRTVALRV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacccgcgcgggttcctgaaggtgcggcaccgcgagctgccgcccaaccgtccg
gtgccggtccgcctgcgcgactggaaggacgtccgcgcccacctcgaggagggtcagccg
ttcctcaaggagcaggcgggacgctgcatggactgcggcatcccgttctgccaccagggc
tgcccgctcgggaacctcatcccggagtggaacgacctggtgtggcgcgaccagtgggcc
gacgccatcgagcggctccacgcgaccaacaacttcccggagttcacggggcgcgtgtgc
ccggcgccgtgcgagacgagctgcgtgctgggcatcaaccagcccgcggtgacgatcaag
aacgtcgaggtctcgatcatcgacgaggcgttcgcgcgcggtctggtgaccccgcaggtg
ccgcagcgcctcacgggctcgacggtcgcggtcgtcggctcggggccggcgggcctcgcg
gcggcgcagcagctcacgcgcgccggccacaccgtcgtcgtgtacgagcgcgacgacgcc
gtgggcggcctgctgcggtacggcatcccggacttcaagctcgagaagcaccacatcgac
cgccgtctggcgcagatggaggccgagggcacccgcttccgccctggcgtggagatcggc
cgggacatcacgtgggacgcgctgcgccgccggttcgacgcggtcgtggtcgccacgggc
gccacggtcccgcgcgacctcgcgctgcccggccgcgacctcggcggcatccacttcgcg
atggacttcctggtccccgcgaacaaggtggtcgccggccgcccggtccctgacgacgtc
ccgcacgcggcgggcaagcacgtggtcgtcatcggcggcggcgacaccggctccgactgc
gtcggcacctcgctgcgccagggcgcggcgtcggtcacgacgctcgcgatcggcaagaag
ccgccgctcgagcggcccgagaaccagccgtggccgaccgacccgatcctcttcgaggtc
tcgacctcgcacgaggagggcggcgagcgcatctacctcgcgtcgaccgtggcgttcctc
ggcgacgacgagggcaacgtccgcgcgctgcgcgtggcggagaccgagtaccttcccgac
gggcgccgcgcgccccggccgggcaccgagcgggagatcccggcggacctcgtgctgatc
gcgatgggcttcacgggcccggagacggacgagctggtggcccagaccggtgcggagacg
acgggccgcgggctcgtgcgccgcggcgacgactacgcgtcgagcgtcccgggcgtcttc
gtgaccggcgacgccggtcgcgggcagtcgctcatcgtgtgggcgatcgccgagggccgc
gccaccgcggccgccgtcgacgcttacctgcagggcagcaccgagctgcccgccccggtg
ggcccccgcacggtcgccctgagagtatga

DBGET integrated database retrieval system