KEGG   Isoptericola variabilis: Isova_1489Help
Entry
Isova_1489        CDS       T01520                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
iva  Isoptericola variabilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isova_1489
   01230 Biosynthesis of amino acids
    Isova_1489
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isova_1489
   00051 Fructose and mannose metabolism
    Isova_1489
   00562 Inositol phosphate metabolism
    Isova_1489
Enzymes [BR:iva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Isova_1489
Exosome [BR:iva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Isova_1489
  Exosomal proteins of bladder cancer cells
   Isova_1489
  Exosomal proteins of melanoma cells
   Isova_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1624314..1625105
Genome map
AA seq 263 aa AA seqDB search
MATTRTPLMAGNWKMNLDHTEAIATVQKLAWILKDAKHDYSAVEVAVLPPFTSLRSVQTL
VDADKLEIRYGAQDLSQHTSGAYTGEISAPMLVRLGCTYVVVGHSERREYHAESDELVAA
KVAVALEHGLAPILCVGEGLDVRKAGDQVSYTLAQLDAALAGVAQEKVSDVVVAYEPVWA
IGTGEVATPEDAQEVCGAIRARLAELYDDETAGAVRVLYGGSVKSGNVAQIMAQPDVDGA
LVGGASLDPEEFARIVRYQAHVA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccacccgcacgccgctcatggcgggcaactggaagatgaacctggaccacacc
gaggcgatcgccacggtccagaagctcgcgtggattctcaaggacgcgaagcacgactac
tcggcggtcgaggtggcggtcctgccgcccttcaccagcctgcgctcggtgcagaccctg
gtcgacgcggacaagctcgagatccgctacggcgcccaggacctgtcgcagcacacctcc
ggggcgtacacgggcgagatctcggcgccgatgctcgtgcgcctcggctgcacgtacgtc
gtggtcggccactccgagcgccgcgagtaccacgccgagagcgacgagctcgtggccgcc
aaggtcgccgtcgcgctcgagcacggcctcgcgccgatcctgtgcgtgggcgagggcctc
gacgtccgcaaggcgggcgaccaggtctcctacaccctcgcgcagctcgacgcggcgctc
gccggcgtcgcgcaggagaaggtgtccgacgtcgtggtcgcctacgagcccgtgtgggcc
atcggcacgggcgaggtcgcgacccccgaggacgcgcaggaggtctgcggcgcgatccgc
gcccgcctggcggagctgtacgacgacgagaccgcgggcgcggtgcgcgtgctctacggc
ggctcggtcaagtcgggcaacgtcgcgcagatcatggcgcagcccgacgtcgacggcgcc
ctcgtcggcggcgcgagcctcgacccggaggagttcgcccgcatcgtgcggtaccaggcg
cacgtcgcctga

DBGET integrated database retrieval system