KEGG   Isoptericola variabilis: Isova_1531Help
Entry
Isova_1531        CDS       T01520                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
iva  Isoptericola variabilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Isova_1531
   00052 Galactose metabolism
    Isova_1531
   00500 Starch and sucrose metabolism
    Isova_1531
   00520 Amino sugar and nucleotide sugar metabolism
    Isova_1531
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Isova_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1668193..1669599
Genome map
AA seq 468 aa AA seqDB search
MSDRGLQLARDKMQAAGVAPAAIETFTRFYRLLESGETGLVREDDVEPLTGLQRHADLEI
SEADAADALARTAIVKLNGGLGTSMGMDRAKSLLTVREGADGEQLTFLDVIVGQVREARR
RTGARLPLILMNSFRTRDDSLAALARYDDLAVEGLPLDFLQNREPKLLADTLEPVEWPAD
PSLEWCPPGHGDLYPALHASGVVRALLDAGFRYACVSNSDNLGAAPDGEIAAWFAASGAP
YAAEMCRKTPADVKGGQLVVRKSDGRIMQRETAQTHPDDLDVSLDAERHPYFHTNNLWFD
LEALAAELDRTGGVLELPLIRNEKTVDPTDPSSPKVVQIESAMGAAVAVFEGATAIEVGR
ERFLPVKTTNDLLVLRSDVYELTDDYRLVAQVDAPLVKLSGVYKTIARFDERFPGGAPSL
REATSLTVEGDWTFGSGVRVIGDGRLPDAGSPQTVPDGALVTAAGVQG
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccgtggactccagctggcccgagacaagatgcaggcggcgggcgtcgcaccc
gccgcgatcgagacgttcacccgcttctaccggctcctggagtcgggggagacgggtctc
gtgcgcgaggacgacgtcgagcccctgaccggcctgcagcggcacgccgacctcgagatc
tcggaggccgacgccgccgacgcgctcgcgcgcaccgcgatcgtcaagctcaacggcggc
ctcggcacctcgatgggcatggaccgcgccaagtcgctgctcaccgtgcgcgagggcgcc
gacggcgagcagctcacgttcctcgacgtcatcgtcggccaggtgcgcgaggcgcgccgg
cgcacgggcgcacgcctgcccctgatcctcatgaactccttccgcacgcgcgacgactcg
ctcgccgcgctcgcgcggtacgacgacctcgccgtcgagggcctgccgctcgacttcctg
cagaaccgcgagcccaagctgctcgccgacacgctcgagcccgtcgagtggcccgccgac
ccgtcgctcgagtggtgcccgcccggccacggtgacctgtaccccgcgctgcacgcctcg
ggcgtggtgcgcgcgctgctcgacgccgggttccggtacgcgtgcgtgtccaactccgac
aacctcggggccgcgcccgacggcgagatcgcggcctggttcgcggcgtcgggcgccccg
tacgcggccgagatgtgccgcaagacgccggccgacgtcaagggcggccagctcgtggtg
cgcaagtccgacgggcgcatcatgcagcgcgagaccgcgcagacccacccggacgacctc
gacgtctcgctcgacgccgagcggcacccctacttccacacgaacaacctctggttcgac
ctcgaggcgctcgccgccgagctcgaccgtacgggcggcgtgctcgagctgccgctcatc
cgcaacgagaagacggtcgacccgaccgacccgtcgtcgccgaaggtcgtccagatcgag
tcggcgatgggcgccgcggtcgcggtcttcgagggcgcgacggcgatcgaggtgggccgc
gagcggttcctgcccgtcaagacgacgaacgacctgctcgtgctgcgctcggacgtctac
gagctcaccgacgactaccggctcgtggcccaggtcgacgcgccgctcgtgaagctgtcc
ggggtgtacaagacgatcgcgcggttcgacgagcggttccccggcggcgcgccgtcgctg
cgcgaggcgacgtccctgacggtcgagggggactggacgttcgggtcgggcgtacgggtc
atcggggacgggcgcctgcccgacgccgggtccccgcagaccgtgcccgatggcgcgctc
gtgaccgcggccggcgtccagggctga

DBGET integrated database retrieval system