KEGG   Isoptericola variabilis: Isova_1609Help
Entry
Isova_1609        CDS       T01520                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
iva  Isoptericola variabilis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Isova_1609
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Isova_1609
Enzymes [BR:iva01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Isova_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1742576..1743571)
Genome map
AA seq 331 aa AA seqDB search
MKHLLSTADLSKDDAILLLDTAAQMAATQSREIKKLPTLRGRTVVNLFFEDSTRTRISFE
TAAKRLSADVINFSAKGSSVSKGESLKDTALTLHAMGADAVVVRHWASGAPYQLAHAGWL
DAAVLNAGDGTHQHPTQALLDAFTIRRHLVGRRGGGDPDGVGADLAGLRVAIVGDVLHSR
VARSNVALLRTLGAEVTLVSPPTLLPVGVESWPCRTSYDLDATLADWRPDAVMMLRVQRE
RMSGGSGGAFFPSPLEYTRYYGLDARRLALLDDHAIVMHPGPMNRGLEISAEAADSDRAV
IVEQVANGVAVRMAALYLLLAGDPSAEGNDL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctgtcgaccgccgacctgagcaaggacgacgcgatcctcctgctcgac
accgccgcgcagatggccgcgacccagtcgcgcgagatcaagaagctgccgacgctgcgc
gggcgcaccgtcgtcaacctgttcttcgaggactcgacgcgcacgcggatctcgttcgag
acggcggccaagcgcctgagcgcggacgtcatcaacttctcggccaagggctcgagcgtg
tccaagggcgagtcgctcaaggacaccgcgctgaccctgcacgccatgggcgccgacgcg
gtcgtcgtgcggcactgggcctcgggcgcgccctaccagctcgcgcacgccggctggctc
gacgccgccgtgctcaacgcgggcgacggcacgcaccagcacccgacccaggcgctgctc
gacgcgttcacgatccgccgccacctcgtgggccggcgcggcggcggcgacccggacggc
gtcggtgcggacctcgcggggctgcgcgtcgcgatcgtcggggacgtgctgcactcgcgc
gtcgcgcgctccaacgtggcgctgctgcgcacgctcggggccgaggtgacgctcgtgtcc
ccgccgacgctgctgcccgtgggcgtcgagagctggccgtgccgcacctcgtacgacctg
gacgccacgctcgccgactggcgccccgacgccgtgatgatgctgcgcgtgcagcgtgag
cgcatgtccggcggctcgggcggcgcgttcttcccgagcccgctcgagtacacgcggtac
tacgggctcgacgcgcggcgcctcgccctgctggacgaccacgcgatcgtcatgcacccc
ggcccgatgaaccgcggcctggagatctcggccgaggccgccgactcggaccgcgccgtc
atcgtcgagcaggtcgccaacggcgtcgccgtgcgcatggccgcgctctacctgctgctg
gccggggacccctcggcggaagggaacgacctgtga

DBGET integrated database retrieval system