KEGG   Isoptericola variabilis: Isova_1728Help
Entry
Isova_1728        CDS       T01520                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
iva  Isoptericola variabilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:iva00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1864802..1866217
Genome map
AA seq 471 aa AA seqDB search
MTVVVALDQGTTNTKALAIDVSGRVVAKASAPVGITTPAAGSVEQDAEEIWTRSVDVLAR
CIDEAGASSVVGLAIANQRESVVAWDRSTGAPTGPVLSWQDSRTAEWCATLGDAQTVGLV
QGRTGLPLDPMFSAPKMAWVLRDADPSTVVGTVDSWLLWNLTGSTEHVIEAGNASRTLLY
RLDKLCWDDDLLALFGIRPSALPEPRRSHGPFGRTACEGLPRGLPVLAVLADSHAALRGH
GGGTPGIVKATYGTGSSVMRGTGSDLEHRQGIATTLAWLDESPTYALEGNIRYSGSALEW
TARMLGLPGAVALGELAAQVPHAGDVAFVPAFGGLGAPHWDPSAVGTITGLGARSTPAHV
ARAAFDAVAHQVADVVQAMVADTSHGRLRADGGATASRLLMQTQADVLGCQVDVAATEDM
AAYGAARAAFSSQGVEIPPAPAGGLYVPRKDSSDRDRARTAWARAVARARY
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgtggtagccctcgatcagggcacgacaaacaccaaggcgctcgcgatcgat
gtcagcggacgggttgtcgccaaggcgagcgcgccggtcggcatcacgacgcccgccgcg
ggcagcgtcgagcaggatgccgaggagatctggacgcgctccgtcgacgtcctcgcacgg
tgcatagacgaggcgggtgcgtcgtcggtggtcgggctcgcgatcgccaaccagcgggag
tcggtcgtcgcctgggaccgctccacgggcgctccgacaggtcccgtcctgagctggcag
gactcgcggaccgccgagtggtgcgcgacgctgggggacgcccagaccgtggggcttgtt
caggggcgcaccggcttgccgctcgaccccatgttcagcgcccccaagatggcatgggtc
ctgcgcgacgccgacccgagcaccgtcgtggggacggtcgactcgtggttgctctggaac
ctcaccgggagtaccgagcacgtcattgaggcgggaaacgcctcgcggaccctgctctat
cgcctcgacaagctgtgctgggacgacgacctgctggcgctgttcggtatacgaccgtct
gcgctgcccgagcctcgccggtcccacgggccgttcggacgcaccgcctgcgaaggtctg
ccccgggggctcccagtgctcgcggtgctcgccgactcgcatgccgcgctgcgcggacac
ggcggcgggacacccgggatcgtcaaggccacctacggcaccgggtcgtcggtcatgcgc
ggcaccggatccgacctcgaacaccgccagggcatcgcgacgacactggcgtggctggac
gaatctccgacgtacgccctcgagggcaacatccgctactccgggtctgctctggagtgg
accgcacgcatgctgggactgccgggggctgtcgcgctcggcgagcttgccgcacaggtg
ccgcacgccggcgacgtcgcgttcgtcccagcgttcggcggcctcggcgcgccgcattgg
gatccctccgccgtcggaacgatcaccgggctcggcgcccgcagcacgcctgcccacgtc
gcccgtgcagccttcgacgcggtcgcccaccaggttgccgacgtcgtgcaggccatggtc
gccgacacctcacatggtcggctccgggccgacggcggggcgacggcctcacgactgctc
atgcagacgcaagcggatgttctcggctgccaggtcgacgtcgccgcgaccgaggacatg
gccgcctacggtgcggcgcgcgcagcgttctcctcccaaggcgtagagatcccacccgcc
cccgccggagggctatacgtcccccgcaaggattcctcggaccgcgacagggcacgcacc
gcatgggcgcgcgccgtggcgcgcgcccgctactga

DBGET integrated database retrieval system