KEGG   Isoptericola variabilis: Isova_1729Help
Entry
Isova_1729        CDS       T01520                                 

Definition
xylose isomerase domain-containing protein TIM barrel
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
iva  Isoptericola variabilis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:iva00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:iva00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1866277..1867266
Genome map
AA seq 329 aa AA seqDB search
MSQPRFGAGLWHFASYVDRYAVDGYAPPVTTLEAIARAGEVGDLSVVDLNYPFTPGVGLD
EVKDALKEAGLAAIGITPEIYLRKFGRGAFTNPDKAVRHATYDLIDEAAGVVRELGADYV
KVWPGQDGWDYPFQVNHHDLWKLAVDGIRQVASPHPDLKFAIEYKPREPRVKMTWDSAAR
SILGIQQTGLDNVGVLLDFGHSLYGGESPADAAQLLIDHGLLYGMDVNDNLRSWDDDLMV
GTVHLTEIFEFFYTLRINNWDGVWQLDQFPFREDTVDTARTSIRFLKALHRALDELDYDG
LREAQERQDPIAAQRLVQDALLSCMRSDK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagccacgattcggcgccgggctctggcacttcgccagctacgtcgaccgctac
gccgtcgacgggtacgccccgcccgtgaccacgctcgaggccatcgctcgcgccggtgag
gtcggcgacctctcggtcgtggacctgaactacccgttcacgcccggtgtcgggctcgac
gaggtcaaggacgcgctcaaggaggccggcctggccgccatcggcatcaccccggagatc
tacctgcgcaagttcggccgtggcgcgttcaccaaccccgacaaggcggtgcggcacgcc
acctatgacctcatcgacgaggccgccggcgtcgtccgcgagctcggtgccgactacgtc
aaggtctggccgggccaggacggctgggactacccgttccaggtcaaccaccacgacctg
tggaagctcgccgtcgacggcatccggcaggtcgcctcgccgcaccccgacctcaagttc
gccatcgagtacaagccccgcgaaccgcgcgtgaagatgacgtgggactcggccgcccgc
tccatcctcggcatccagcagaccggcctggacaacgtcggcgtcctgctcgacttcggt
cactcgctgtacgggggcgaatcgcctgccgacgccgcacagctgctcatcgaccacggc
ctcctctacggcatggacgtcaacgacaacctgcgcagctgggacgacgacctgatggtc
ggcacggtccacctgacggagatcttcgagttcttctacacgctgcgcatcaacaactgg
gacggcgtgtggcagctcgaccagttccccttccgcgaagacaccgtcgacaccgcgcgc
acgtccatccgctttctcaaggcgctccaccgcgcactggacgagctggactacgacgga
ctccgtgaggcccaggaacggcaggaccccatcgccgcgcagcgcctggtccaggacgcg
ctgctgagctgcatgaggagcgacaagtga

DBGET integrated database retrieval system