KEGG   Isoptericola variabilis: Isova_1817Help
Entry
Isova_1817        CDS       T01520                                 

Definition
ROK family glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
iva  Isoptericola variabilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isova_1817
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isova_1817
   00052 Galactose metabolism
    Isova_1817
   00500 Starch and sucrose metabolism
    Isova_1817
   00520 Amino sugar and nucleotide sugar metabolism
    Isova_1817
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Isova_1817
   00524 Butirosin and neomycin biosynthesis
    Isova_1817
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Isova_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1964642..1965586)
Genome map
AA seq 314 aa AA seqDB search
MHAIGVDIGGTKIAVGVVDEAGKILAQVRRDTDADDVAGIDRAIADACAELAKEHEVGAI
GLAAAGFVSPDRTSVLFAPNIAWREYPLAARVGALLDLDVPIVVENDANAAGWAEFRFGA
ARDATDMLMLTVGTGLGGAIVVDRELVRGKWGVAAEVGHMRVVPGGHYCGCGHEGCWEQY
ASGSALTRDARHAVIAQPHRAGRLLALAGGDADAVTGPMVTTAAKEGDELSVELLANLGR
WVGEGAASVAALLDPELIVVGGGVGAAGELLLTPIRKAYESQLSALGHRPVAQIELAEHG
NEAGIVGAADLARR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccatcggagtcgacatcggcggcaccaagatcgccgtgggcgtggtggacgag
gccggcaagatcctcgcccaggtccgccgcgacaccgacgccgacgacgtggcgggcatc
gaccgtgcgatcgccgacgcctgcgccgagctggccaaggagcacgaggtcggcgcgatc
ggcctcgccgccgccggcttcgtgagcccggaccgcacctcggtcctcttcgcgcccaac
atcgcgtggcgcgagtacccgctcgccgcccgcgtcggtgcgctgctcgacctcgacgtc
ccgatcgtcgtcgagaacgacgccaacgccgccgggtgggccgagttccgcttcggcgcc
gcgcgcgacgcgacggacatgctcatgctcaccgtcggcaccgggctcggcggcgcgatc
gtcgtcgaccgcgagctcgtgcgcggcaagtggggcgtggcggccgaggtcggccacatg
cgcgtcgtgccgggcgggcactactgcggctgcggccacgagggctgctgggagcagtac
gcgtcgggcagcgccctgacgcgcgacgcccgccacgccgtgatcgcccagccgcaccgc
gccgggcgcctgctcgcgctcgcgggcggcgacgcggacgccgtcaccggccccatggtc
accacggccgccaaggagggcgacgagctctcggtcgagctcctggccaacctcgggcgc
tgggtgggcgagggcgccgcgtccgtcgccgcgctgctggaccccgagctcatcgtcgtg
ggcggcggcgtcggcgccgcgggcgagctgctgctcacgccgatccgcaaggcctacgag
tcccagctctccgcgctcgggcaccgcccggtcgcccagatcgaactcgccgagcacggc
aacgaggcgggcatcgtgggcgcggccgacctggcccggcgctga

DBGET integrated database retrieval system