KEGG   Isoptericola variabilis: Isova_1852Help
Entry
Isova_1852        CDS       T01520                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
iva  Isoptericola variabilis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isova_1852
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isova_1852
  Amino acid metabolism
   00310 Lysine degradation
    Isova_1852
Enzymes [BR:iva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Isova_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1997574..1999415
Genome map
AA seq 613 aa AA seqDB search
MSENVQMPALGESVTEGTVTRWLKQVGDTVEVDEPLLEVSTDKVDTEIPSPVAGVLEQIL
VEEDETVEVGADLAVIGDGSGAGGGEAAPAAEPAAEEQAPAEEPAEEPAEQKQAEVPAAE
AAPGPAAAAQEDSGAQGGSQGGGEGTEVTLPALGESVTEGTVTRWLKQVGDTVEVDEPLL
EVSTDKVDTEIPSPVAGTLQEIRVAEDETVEVGAVLAVVGSGAGAPAKAEAPAAEPVGAP
EPAPTPEPEPEPEPAPQAEAPAAPEQPAEPQKPAAEPAKPAPAAPAAPAAQEKPAAQAGG
KSSYLTPLVRKLAAEKGVDVASIQGTGVGGRIRKEDVLAAAEKAAQAQAPAAAAAPAGGA
PAAKAPSIPEPSPLRGTTEKMSRLRKIVAERMVEALHTQAQLTTVVEVDVTKVAKLRAKA
KESFKAREGANLTFLPFYTLAAVEALKAFPKINASIDPEKGEITYHGSENVGIAVDTERG
LVVPVIKNAGDLNLAGIARQIADLASRTRANKVGPDELSGATFTITNTGSGGALIDTPIV
PVGQVAILGTGTITKKPVVVTQPDGEETIAIRQMAYLFLSYDHRLVDGADAARFLTAVKA
RIEEGAFESEVGL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaacgtgcagatgcctgcactcggcgagtccgtcaccgagggcaccgtcacc
cgttggctcaagcaggtcggcgacaccgtcgaggtcgacgagcccctgctcgaggtctcc
accgacaaggtcgacaccgagatcccctcgcccgtcgctggcgtgctcgagcagatcctc
gtcgaggaggacgagacggtcgaggtcggcgccgacctcgcggtcatcggcgacggctcc
ggcgcgggcggcggcgaggccgccccggccgccgagcccgcggccgaggagcaggcgccg
gccgaggagcccgcggaggagcccgccgagcagaagcaggccgaggtcccggccgccgag
gcggcgcccggcccggccgcggccgcgcaggaggactccggcgcccagggcggctcgcag
ggcggcggcgagggcaccgaggtcacgctgcccgcgctgggcgagtccgtcaccgagggc
accgtcacgcgctggctcaagcaggtcggcgacacggtcgaggtcgacgagccgctgctc
gaggtctcgacggacaaggtcgacaccgagatcccctcgccggtcgccggcacgctccag
gagatccgcgtcgccgaggacgagacggtcgaggtcggcgccgtgctcgcggtcgtcggc
tccggggccggcgcaccggcgaaggccgaggcgcccgcggccgagcccgtcggcgctccc
gagcccgccccgacgccggagccggagcccgagcccgagcccgccccgcaggccgaggct
ccggccgcgccggagcagcccgccgagccccagaagccggcggccgagccggcgaagccc
gcacccgcggcgcccgccgcaccggccgcgcaggagaagccggcggcccaggccggcggc
aagtcctcgtacctcacgccgctcgtgcgcaagctcgcggccgagaagggcgtcgacgtc
gcctccatccagggcaccggcgtcggcggccgcatccgcaaggaggacgtcctggcggcg
gcggagaaggccgcgcaggcccaggcgcccgccgccgctgccgctccggccggcggtgct
cctgccgccaaggcgccgagcatccccgagccgtcgccgctgcgcggcacgaccgagaag
atgtcgcgcctgcgcaagatcgtggccgagcgcatggtcgaggccctgcacacgcaggcc
cagctcaccacggtcgtcgaggtcgacgtcaccaaggtcgccaagctccgcgcgaaggcg
aaggagtcgttcaaggcgcgcgagggcgcgaacctcacgttcctgcccttctacacgctc
gcggcggtcgaggcgctcaaggcgttcccgaagatcaacgcgtcgatcgaccccgagaag
ggcgagatcacgtaccacggctcggagaacgtgggcatcgcggtcgacaccgagcgcggc
ctggtcgtcccggtcatcaagaacgcgggcgacctcaacctggccggcatcgcccgccag
atcgccgacctcgcctcgcggacccgcgccaacaaggtgggcccggacgagctgagcggc
gcgacgttcaccatcaccaacaccggctcgggcggcgcgctcatcgacacgccgatcgtc
ccggtcggtcaggtcgcgatcctcggcaccggcacgatcacgaagaagcccgtggtcgtc
acgcagcccgacggcgaggagaccatcgcgatccgccagatggcgtacctgttcctctcc
tacgaccaccggctggtcgacggcgccgacgcggcccggttcctcacggcggtcaaggcc
cgcatcgaggagggcgcgttcgagtccgaggtcggcctctga

DBGET integrated database retrieval system