KEGG   Isoptericola variabilis: Isova_1870Help
Entry
Isova_1870        CDS       T01520                                 

Definition
polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
iva  Isoptericola variabilis
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:iva01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:iva00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:iva00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2017477..2018256
Genome map
AA seq 259 aa AA seqDB search
MQENSTDHPLAFGIDVGGSGIKGAPVDLVTGELAADRKRIKTPSASTPDAVAAILSELVD
SFDLPEDVPVGVAFPAPMDHGVVRFIANLDKSWKGVNLPELVHDATGRRCTAVNDADAAG
VGEQRYGAAKGVDGVVLVATLGTGIGSALLVDGVLVPNTELGHLEIDGHDAESRAADSAR
EREGLSWEKWAKRLQRYFETVEMLLSPDLVVVGGGVSKHHEKYLPLLDLRAPIIPATLRN
AAGIVGAAALAAAERPLVR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactccaccgatcacccgctcgcgttcggcatcgacgtcggcgggtcgggc
atcaagggcgcgcccgtggacctcgtgaccggcgagctcgccgccgaccgcaagcgcatc
aagacgccgtcggcgtcgacgcccgacgccgtcgccgcgatcctgtccgagctggtcgac
tcgttcgacctgccggaggacgtgccggtcggggtcgccttcccggcgccgatggaccac
ggcgtcgtgcggttcatcgccaacctcgacaagtcgtggaagggcgtgaacctccccgag
ctcgtgcacgacgcgaccggccgccgctgcaccgcggtcaacgacgccgacgccgcgggc
gtgggcgagcagcggtacggcgcggcgaagggcgtcgacggcgtcgtcctggtcgccacg
ctcggcaccggcatcggctcggcgctcctcgtcgacggcgtgctcgtgcccaacacggag
ctcggccacctcgagatcgacgggcacgacgccgagtcgcgggccgcggactcggcgcgc
gagcgcgagggcctgtcgtgggagaagtgggcgaagcggctccagcgctacttcgagacc
gtcgagatgctgctctcccccgacctcgtcgtcgtcggcggcggggtgagcaagcaccac
gagaagtacctgccgctgctcgacctgcgggcaccgatcatccccgcgacgctgcgcaac
gccgcgggcatcgtcggcgcggcggcgctggccgcggccgagcgcccgctcgtgcgctga

DBGET integrated database retrieval system