KEGG   Isoptericola variabilis: Isova_1900Help
Entry
Isova_1900        CDS       T01520                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
iva  Isoptericola variabilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Isova_1900
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Isova_1900
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Isova_1900
Enzymes [BR:iva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Isova_1900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2044426..2045976
Genome map
AA seq 516 aa AA seqDB search
MSVPSQTISRRHLLQLGGVGAATLALGISAPETAIARSAPSSAEGLFGLGVASGAPGPDS
AVLWTRLAPEPLAEDGHGGMPLHAYSVHWEVATDAAFVDVVRKGHALAQPDLAHAVHPKV
TGLSPGTEYYYRFRSGERYSPVGRFRTLPGPGALAERFTFGVVSCQAWYHGHFTAYKHLA
ADPELDLMVFTGDCIYEYGITSANLWRHGASVTAAHAAEVQTLEQYRLRYALFKSDPHLQ
ALHARVPAVVIWDDHEVQNNYVAGTSAYGLEDDLFEHRVAVAYRAFYENLPLDLDALPHG
PTGDITTGFDVGALARFTLLDTRQHRDPVPTSPEDQHAEDRTMLGAEQEAWVTERLTRSP
AVWNVLASGVVLTAITENRTDQWDGYPAARRRLLDAMARSRNTVVVTGDIHHAVAAELRA
DFDDPTSANVGVELICTSVASDGDGAPTHGYAPDWLQHDYVKLYDGRRGYLTVSLAPDQM
TSTFVIVPWIEADDTAPRQVLARFTTPARQPRLDRA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgccatctcagacgatcagccgccgtcacctgctgcagctgggcggtgtcggc
gccgccacgttggcgctggggatcagcgcacccgagacggcgatcgcacggtcggcaccg
agctcagccgaaggcctcttcggtctgggggtggcgagcggcgcacccggcccggactcc
gcggtgctgtggacccggctcgcgcccgagccgctcgccgaggacggccacggcggcatg
cctctgcacgcgtactcggtgcactgggaggtcgccaccgacgcggcgttcgtcgacgtg
gtccgcaagggccacgcgttggcccagccggacctcgcgcacgcggtgcacccgaaggtc
accgggctgagcccgggcaccgagtactactaccggttccggtcgggtgagcggtacagc
ccggtcggtcgcttccgcaccctgcccgggcccggggccctcgccgagcggttcacgttc
ggcgtggtgtcctgccaggcctggtaccacggccacttcaccgcctacaagcacctggcc
gccgaccccgagctcgacctcatggtcttcaccggcgactgcatctacgagtacggcatc
acgtcggcgaacctgtggcgccacggcgcctcggtgaccgccgcccacgccgccgaggtg
cagacgctcgagcagtaccggctgcgctacgcgctcttcaagagcgacccccacctgcag
gcgctgcacgcgcgcgtgcccgccgtcgtgatctgggacgaccacgaggtgcagaacaac
tacgtcgccggcacgtccgcgtacggcctcgaggacgacctgttcgagcaccgcgtcgcg
gtcgcctaccgggcgttctacgagaacctccccctggacctggacgcgctgccccatggc
ccgaccggggacatcaccaccggcttcgacgtcggcgcccttgcccggttcaccctcctc
gacacccgccagcaccgcgacccggtccccacgagccccgaggaccagcacgccgaggac
cggaccatgctcggcgccgagcaggaggcctgggtgaccgagcggctcacccggagcccg
gcggtctggaacgtgctggccagcggcgtggtcctcacggccatcaccgagaaccgcacc
gaccagtgggacggctatcccgccgcgcgacgccggctgctcgacgccatggcccgcagc
cgcaacaccgtcgtggtgaccggcgacatccaccacgcggtcgccgccgagctccgggcc
gacttcgacgacccgacctcggcgaacgtcggcgtggagctgatctgcacctccgtcgcg
tccgacggcgacggcgcgccgacccacggctacgcccccgactggctccagcacgactac
gtcaagctctacgacggccgccgcggctacctcaccgtcagcctcgcaccggaccagatg
acgtcgacgttcgtcatcgtgccctggatcgaggcggacgacaccgcgccaaggcaggtc
ctcgctcgcttcaccactcccgcccgccagccccggctcgaccgggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system