KEGG   Isoptericola variabilis: Isova_2070Help
Entry
Isova_2070        CDS       T01520                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
iva  Isoptericola variabilis
Brite
Enzymes [BR:iva01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Isova_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2230642..2231247
Genome map
AA seq 201 aa AA seqDB search
MRATRLPTGSGGVDDVVTAALRAVDRRGFLPDARHRHAGEDRPLDIGQGQTCSQPSTVSA
MLRLLDVPRGAHVLDVGAGSGWTTALLAHLVGPDGEVLGVERHQELAAWGAANVERAGMP
WARVVEATPGVLGAPRPGGWDRVLVSAAADRLPDELVDQVAPGGRMVIPVRHAMVLVERS
DDGRVRTSEHGTYSFVPLVED
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagggccacccgcctccccacgggatccggcggcgtcgacgacgtggtcacggccgcg
ctgcgcgccgtcgaccggcgcgggttcctgcccgacgcgcggcaccggcacgccggcgag
gaccgcccgctcgacatcgggcagggccagacctgctcgcagccgtcgaccgtctcggcg
atgctgcgcctgctcgacgtgccccggggggcgcacgtgctcgacgtcggcgcgggatcg
gggtggacgacggcgctgctcgcgcacctcgtcgggccggacggcgaggtgctcggcgtc
gagcggcaccaggagctcgccgcgtggggcgcggcgaacgtcgagcgcgccggcatgccg
tgggcgcgggtcgtcgaggcgaccccgggcgtgctgggcgcgccgcgcccgggcgggtgg
gaccgcgtcctcgtctccgcggccgcggaccgcctccccgacgagctcgtggaccaggtc
gcgcccggcggacgcatggtcatccccgtgcggcacgcgatggtgctggtcgagcggtcc
gacgacggacgcgtgcgcacgagcgagcacgggacgtactcgttcgtcccgctggtcgag
gactga

DBGET integrated database retrieval system