KEGG   Isoptericola variabilis: Isova_2246Help
Entry
Isova_2246        CDS       T01520                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
iva  Isoptericola variabilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Isova_2246
Enzymes [BR:iva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Isova_2246
Exosome [BR:iva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Isova_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2439854..2442109
Genome map
AA seq 751 aa AA seqDB search
MTSGPHEQQTSQDPSAPPAAPPVDTEVLTAVAQGTTHDPHAVLGPHLMPDTGDGRSWAVV
RTLRPLADEVVVVTADGEFPASHDAAGVWTAVVPTPVDDDGTRHAPDYRVRTRYGTDVQT
ADDPYRFLPTLGEMDLHLVSEGRHEELWRVLGANLHRYHSVLGDVDGTSFAVWAPNARGV
RVVGDHNRWTPIHPMRSLGSSGVWELFVPGVGPGTRYKYEILGADGVWRAKADPLAKGTE
VPPATASVVVESRHEWGDLDWMTARASHDPHNGPMSVYEVHLGSWRPGLGYRELAEQLTD
YVTEQGFTHVELMPVAEHPFGGSWGYQVTSYFAPTSRFGHPDDFRYLVDRLHQAGVGVIL
DWVPAHFPRDEFALARFDGTPLYEHADPRRGEQPDWGTYVFDFGRREVRNFLVANASYWF
EEFHADALRVDAVASMLYLDYSRNEGEWVPNVHGGRENLEAISFLQEANATAYRRNPGVM
MIAEESTAFPGVTRPTSSGGLGFGLKWNMGWMNDSLRYVAHDPMYRRYHHGELTFSLVYA
FSEQYVLPISHDEVVHGKGSLLRKMPGDGWQQLAGVRAFLAYQWTHPGKQLLFMGQEFAQ
DAEWNEGVGLDWWLLENPGHAGVQRAVRDLNRLYRETPALWERDFEGGGFEWLDADDADH
NVLSYVRRDRSGRPVVVVVNFAGTPHEGYRLALPDAGTWVEAFNSDAEVYGGSGVGNLGS
VTAEPVPWKGRSHSVSLRVPPLGALILVPQR
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccggcccgcacgaacagcagacctcccaggacccgtcggccccgcccgccgcg
ccgcccgtcgacaccgaggtgctcaccgccgtcgcgcagggcacgacgcacgacccgcac
gcggtgctcggtccccacctcatgcccgacaccggcgacgggcgctcgtgggccgtcgtg
cgcacgctgcgcccgctcgccgacgaggtcgtcgtggtgaccgccgacggcgagttcccc
gcgtcgcacgacgccgcgggcgtgtggaccgccgtcgtgccgacgccggtggacgacgac
ggcacgcgccacgcgcccgactaccgcgtgcgcacgcgctacggcaccgacgtgcagacc
gccgacgacccgtaccggttcctgcccacgctcggggagatggacctgcacctcgtgagc
gagggccgccacgaggagctgtggcgggtgctcggcgccaacctgcaccgctaccacagc
gtgctcggcgacgtcgacggcacctcgttcgcggtgtgggcgccgaacgcgcgcggcgtg
cgcgtcgtcggcgaccacaaccgctggacgccgatccacccgatgcgctcgctcggctcc
tcgggcgtgtgggagctgttcgtccccggcgtcgggccgggcacgcggtacaagtacgag
atcctcggcgcggacggcgtgtggcgcgccaaggccgacccgctcgccaagggcacggag
gtcccgcccgcgacggcgagcgtcgtcgtcgagtcccgccacgagtggggcgacctcgac
tggatgacggcccgcgcgtcgcacgacccgcacaacggcccgatgagcgtctacgaggtg
cacctcggctcgtggcggcccgggctcggctaccgcgagctcgcggagcagctcaccgac
tacgtcaccgagcagggcttcacccacgtcgagctcatgcccgtcgccgagcacccgttc
ggcggctcctggggctaccaggtcacgagctacttcgcgccgacgtcgcggttcggccac
ccggacgacttccggtacctcgtggaccggctgcaccaggccggggtcggcgtgatcctc
gactgggtgcccgcgcacttcccgcgcgacgagttcgcgctcgcgcgcttcgacggcacg
ccgctgtacgagcacgccgacccgcgccggggcgagcagcccgactggggcacgtacgtc
ttcgacttcggccgccgcgaggtgcgcaacttcctcgtcgccaacgcgagctactggttc
gaggagttccacgccgacgcgctgcgcgtcgacgccgtggcctcgatgctctacctcgac
tactcgcgcaacgagggcgagtgggtgccgaacgtgcacggcggtcgcgagaacctcgag
gcgatctcgttcctccaggaggcgaacgcgacggcgtaccgccgcaacccgggcgtcatg
atgatcgccgaggagtccacggcgttcccgggcgtcacgcggccgacgagcagcggcggc
ctcgggttcggcctgaagtggaacatgggctggatgaacgacagcctgcggtacgtcgca
cacgaccccatgtaccggcgctaccaccacggcgagctgacgttctcgctcgtgtacgcg
ttctccgagcagtacgtgctgcccatcagccacgacgaggtcgtgcacggcaaggggtcc
ctgctgcgcaagatgccgggcgacggctggcagcagctcgccggcgtgcgcgcgttcctc
gcctaccagtggacgcacccgggcaagcagctgctcttcatgggccaggagttcgcgcag
gacgccgagtggaacgagggcgtcgggctcgactggtggctcctcgagaatcccgggcac
gccggcgtccagcgggcggtgcgcgacctcaaccgcctctaccgcgagacgccggccctc
tgggagcgcgacttcgagggcggcgggttcgagtggctcgacgccgacgacgccgaccac
aacgtcctgtcgtacgtgcgccgcgaccgctccgggcggcccgtcgtcgtcgtggtcaac
ttcgctggcaccccgcacgagggctatcggctcgcgctgcccgacgccggcacgtgggtc
gaggcgttcaacagcgacgccgaggtgtacgggggttccggcgtgggcaacctcggcagc
gtgaccgccgagcccgtgccgtggaagggccggtcgcactcggtgtcgctgcgcgtgccg
ccgctgggcgccctcatcctcgtgccgcagcggtag

DBGET integrated database retrieval system