KEGG   Isoptericola variabilis: Isova_2276Help
Entry
Isova_2276        CDS       T01520                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
iva  Isoptericola variabilis
Pathway
iva00330  Arginine and proline metabolism
iva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Isova_2276
Enzymes [BR:iva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Isova_2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEG44996
JGI: Isova_2276
UniProt: F6FR46
Position
complement(2473514..2474719)
Genome map
AA seq 401 aa AA seqDB search
MSHDHDHDHDHHHDLWPEGFWEQPRRLGEGLEGHAATDDYNAGRPPGLLFANRKAEGGFS
GIQTFGKLPVALTPEDLRAANVDVAVLGVPWDSTATGRTGTNHGPLAIRACDYKGGYGRP
HFSLDTHVDAFAELVMADYGDAPVSVGNTARTFEGIRKFVGTVVDAGAIPIILGGDHAIT
WPCATAVADHYGHGKVGIVHFDAHADTGDDMPGSLASHGTPMRHLINSGAIPGKNFVQVG
LRGYWPDQQTLDWMDDQKMRTHFMAEIVRDGFDKVLERAVDEALDQADHLYISLDIDVCD
PAYAPGTGTPEPGGITSNDILRAVRRLAAEVGIVAMDVVEVSPPYDDRGEITALLANRSV
REAMTGIAMRRKGVTEPDYLHPYAVGLDEHGNRRNRVFREA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgaccacgaccacgaccacgaccaccaccacgacctgtggccagagggcttc
tgggagcagccccggcgcctgggcgaagggctcgagggacacgccgccaccgacgactac
aacgcgggccgcccgcccggtctgctgttcgccaaccgcaaggccgagggcgggttctcg
ggcattcagacgttcggcaagctgccggtggcgctcacgcccgaggacctgagggcggcg
aacgtggacgtcgccgtgctcggggtgccgtgggactcgacggcgacgggccgtaccggc
accaaccacgggccgctcgctatccgggcgtgcgactacaagggcggctacggccggccg
cacttctccctcgacacccacgtcgacgcgttcgccgagctcgtgatggcggactacggc
gacgctccggtctccgtcggcaacaccgcccgcacgttcgaggggatccgcaagttcgtc
ggcacggtggtcgacgccggcgccatcccgatcatcctgggcggcgaccacgcgatcacg
tggccgtgcgccacggccgtcgcggaccactacgggcacggcaaggtcggcatcgtccac
ttcgacgcccacgccgacaccggggacgacatgcccggctcgctcgcctcgcacggcacc
cccatgcgacacctcatcaactccggggcgatccccggcaagaacttcgtccaggtgggc
ctgcgcggctactggcccgaccagcagacgctcgactggatggacgaccagaagatgcgc
acgcacttcatggccgagatcgtccgcgacgggttcgacaaggtcctcgagcgcgctgtc
gacgaggcgctcgaccaggcggaccacctctacatctcgctggacatcgacgtctgcgac
cccgcctacgcccctggcaccggcacccccgagccgggcggcatcacgtccaacgacatc
ctccgcgccgtgcgccggctggccgccgaggtcgggatcgtcgccatggacgtcgtcgag
gtctccccgccctacgacgaccgcggcgagatcacggcactgctcgcgaaccgctcggtg
cgcgaggccatgaccggcatcgcgatgcgccgcaagggcgtcaccgagccggactacctg
cacccctacgccgtcggtctcgacgagcacggcaaccgccgcaaccgcgtcttccgcgag
gcctga

DBGET integrated database retrieval system