KEGG   Isoptericola variabilis: Isova_2276Help
Entry
Isova_2276        CDS       T01520                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
iva  Isoptericola variabilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:iva00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2473514..2474719)
Genome map
AA seq 401 aa AA seqDB search
MSHDHDHDHDHHHDLWPEGFWEQPRRLGEGLEGHAATDDYNAGRPPGLLFANRKAEGGFS
GIQTFGKLPVALTPEDLRAANVDVAVLGVPWDSTATGRTGTNHGPLAIRACDYKGGYGRP
HFSLDTHVDAFAELVMADYGDAPVSVGNTARTFEGIRKFVGTVVDAGAIPIILGGDHAIT
WPCATAVADHYGHGKVGIVHFDAHADTGDDMPGSLASHGTPMRHLINSGAIPGKNFVQVG
LRGYWPDQQTLDWMDDQKMRTHFMAEIVRDGFDKVLERAVDEALDQADHLYISLDIDVCD
PAYAPGTGTPEPGGITSNDILRAVRRLAAEVGIVAMDVVEVSPPYDDRGEITALLANRSV
REAMTGIAMRRKGVTEPDYLHPYAVGLDEHGNRRNRVFREA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgaccacgaccacgaccacgaccaccaccacgacctgtggccagagggcttc
tgggagcagccccggcgcctgggcgaagggctcgagggacacgccgccaccgacgactac
aacgcgggccgcccgcccggtctgctgttcgccaaccgcaaggccgagggcgggttctcg
ggcattcagacgttcggcaagctgccggtggcgctcacgcccgaggacctgagggcggcg
aacgtggacgtcgccgtgctcggggtgccgtgggactcgacggcgacgggccgtaccggc
accaaccacgggccgctcgctatccgggcgtgcgactacaagggcggctacggccggccg
cacttctccctcgacacccacgtcgacgcgttcgccgagctcgtgatggcggactacggc
gacgctccggtctccgtcggcaacaccgcccgcacgttcgaggggatccgcaagttcgtc
ggcacggtggtcgacgccggcgccatcccgatcatcctgggcggcgaccacgcgatcacg
tggccgtgcgccacggccgtcgcggaccactacgggcacggcaaggtcggcatcgtccac
ttcgacgcccacgccgacaccggggacgacatgcccggctcgctcgcctcgcacggcacc
cccatgcgacacctcatcaactccggggcgatccccggcaagaacttcgtccaggtgggc
ctgcgcggctactggcccgaccagcagacgctcgactggatggacgaccagaagatgcgc
acgcacttcatggccgagatcgtccgcgacgggttcgacaaggtcctcgagcgcgctgtc
gacgaggcgctcgaccaggcggaccacctctacatctcgctggacatcgacgtctgcgac
cccgcctacgcccctggcaccggcacccccgagccgggcggcatcacgtccaacgacatc
ctccgcgccgtgcgccggctggccgccgaggtcgggatcgtcgccatggacgtcgtcgag
gtctccccgccctacgacgaccgcggcgagatcacggcactgctcgcgaaccgctcggtg
cgcgaggccatgaccggcatcgcgatgcgccgcaagggcgtcaccgagccggactacctg
cacccctacgccgtcggtctcgacgagcacggcaaccgccgcaaccgcgtcttccgcgag
gcctga

DBGET integrated database retrieval system