KEGG   Isoptericola variabilis: Isova_2289Help
Entry
Isova_2289        CDS       T01520                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
iva  Isoptericola variabilis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Isova_2289
Enzymes [BR:iva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Isova_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2490027..2492087)
Genome map
AA seq 686 aa AA seqDB search
MPVMTQAEGAGARFAALTDDVGLLYGGDYNPEQWDPATWREDARLMQEAGVNLVTVGVFS
WARYEPRPGVRDFAWLDEVIELLHAHGVGVDLATPTASPPAWLGHLYPETLPVDADGVRL
VAGSRNHFSPASRVYREHALAIAADLVDRYADHPAVRMWHVGNEFGQVCYGDESAREFRR
WLRERYGTIERLNQAWGTTFWSQRYDDWEEILPPRRMPYHPNPTQALDFRRYSSDQLLAL
YREQRDLVRARDPRRPITTNLMGFFPLADYWSWADDLDVVADDAYPDPGDPDAPADSALT
QDLVRSLGGGRPWVLMEQAAGAVSWRDHNLPKSPERSRLESLQAVARGADGVCFFQWRAS
RAGAERFHSAMLPHAGPDTRAHAGIRRLGADLRRLRPVVGTRVAATVALLFDWESWWAAH
ELARPTTRLDTLAQLRAWYRPLWEAGVAADVVHPRTALDPYDVVLVPQTYLLDERAAAGV
TVAVERGASAVVGPFTGVADENAHVRTGRFPALLRDLLRVGGEEWAPLPDGGVRLVVEPD
GWRSAAGVAADAHAAIFGEALRAEGATVLARFAEGHLAGLPAVTCARTGAGHAWYVGTVP
DAPLLERVVGDALDAAGVAPVLPGVRAVDGLEAVRRGDALFLLNHSDVDARVPVPAPATD
LLTGAPVDGEAHVPATGAVVLIERQR
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtgatgacgcaggccgagggcgcgggggcgcggttcgccgcgctcacggacgac
gtcgggctgctgtacggcggggactacaaccccgagcagtgggacccggccacctggcgc
gaggacgcgcggctcatgcaggaggcgggcgtcaacctcgtgaccgtcggggtgttctcc
tgggcccggtacgagccgcgtcccggcgtccgtgacttcgcctggctcgacgaggtgatc
gagctgctgcacgcgcacggcgtgggcgtggacctggcgacgccgacagcgtcgccgccc
gcctggctcgggcacctctacccggagaccctgcccgtcgacgccgacggcgtgcggctc
gtggccggatcccgcaaccacttctcgccggcgtcgcgcgtgtaccgcgagcacgcgctc
gcgatcgccgccgacctggtggaccggtacgcggaccaccccgccgtgcggatgtggcac
gtcggcaacgagttcggccaggtctgctacggcgacgagtcggcgcgggagttccgccgg
tggctgcgcgagcgctacggcaccatcgagcgcctcaaccaggcctggggcacgacgttc
tggtcccagcgctacgacgactgggaggagatcctcccgccgcggcgcatgccctaccac
cccaacccgacgcaggcgctcgacttccggcggtactcgtccgaccagctcctcgctctc
taccgcgagcagcgcgacctcgtccgcgcgcgcgacccgcggcggccgatcaccaccaac
ctcatgggcttcttcccgctcgcggactactggtcctgggcggacgacctcgacgtggtg
gccgacgacgcctacccggaccccggcgaccccgacgcgccggccgactcggcgctgacc
caggacctcgtgcgctcgctcggcggcgggcggccgtgggtgctcatggagcaggcggcg
ggggccgtgagctggcgcgaccacaacctccccaagtcccccgagcggtcacggctcgag
tcgctccaggcggtcgcgcgcggcgcggacggcgtgtgcttcttccagtggcgcgcctcg
cgcgcgggggccgagcggttccactcggcgatgcttccccacgcgggtcccgacacgcgg
gcccacgccgggatccggcgcctcggcgccgacctgcgtcggctccgaccggtcgtcggc
acccgggtcgccgccacggtcgcgctgctcttcgactgggagtcgtggtgggccgcccac
gagctcgcccgacccacgacgaggctcgacacgctcgcgcagctgcgggcgtggtaccgc
ccgctgtgggaggccggggtcgcggcggacgtcgtccacccacggacggccctcgacccc
tacgacgtcgtgctcgtgccgcagacgtacctgctcgacgagcgcgcggcagccggcgtg
accgtggccgtcgagcggggcgccagcgccgtcgtcggaccgttcaccggcgtcgccgac
gagaacgcgcacgtgcgcaccggccggttccccgccctcctgcgtgacctgctgcgcgtc
ggcggcgaggagtgggcgccgctgcccgacggcggcgtccggctggtcgtcgaaccggac
ggctggcggagcgcggccggcgtcgccgcggacgcgcacgccgcgatcttcggcgaggcg
ctgcgtgccgagggcgcgacggtcctcgcgcggttcgccgagggacacctcgccggcctg
cccgccgtgacgtgcgcccggacgggcgcgggccacgcctggtacgtcggcacggtcccc
gacgcacccctgctcgagcgggtcgtcggcgacgcgctcgacgcggcgggggtcgccccc
gtcctgcccggcgtccgtgccgtcgacgggctcgaggccgtgcgccgtggcgacgccctg
ttcctgctcaaccactccgacgtcgacgcccgggtcccggtcccggcaccggcgacggac
ctgctcaccggagcgccggtggacggcgaggcgcacgtccccgccacgggcgccgtcgtc
ctgatcgagaggcaacgatga

DBGET integrated database retrieval system