KEGG   Isoptericola variabilis: Isova_2315Help
Entry
Isova_2315        CDS       T01520                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
iva  Isoptericola variabilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:iva01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:iva00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:iva00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2520849..2521958)
Genome map
AA seq 369 aa AA seqDB search
MPANQWRGVIREYAERLPEHVTREVVTLGEGGTPLVPAPALSERTGAEVYVKVEGMNPTG
SFKDRGMTTAISAAAGRGARAVVCASTGNTSASAAAYAARAGMVCAVLVPDGKIAMGKLS
QAIAHGAQLLQVDGNFDDCLVAARKLAEVHPVELVNSVNPDRIEGQKTAAFEVVDVLGDA
PDIHALPVGNAGNITAYWKGYLEYAGVATSETGPGAAPTAVASRTPRMWGFQAAGAAPIV
KGHPVDQPETIATAIRIGNPASWQQAEAARDDSGGVIEAVTDEQILAAHRLLSSEVGVFV
EPASAAGVAGLLDRAERGLVPAGARVVVTVTGHGLKDPGWALRTADGSEVVPTRVSADVV
SIADALGLG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaaccagtggcgcggcgtgatccgcgagtacgccgagcgcctgcccgagcac
gtgacgcgcgaggtggtgacgctcggcgagggcgggaccccgctcgtcccggcgccggcg
ctgtccgagcgcacgggcgccgaggtgtacgtcaaggtcgagggcatgaacccgacgggg
tccttcaaggaccgcgggatgacgacggccatctcggcggccgcgggccgcggggcgcgc
gcggtcgtgtgcgcctcgacgggtaacacctccgcgtccgccgccgcctacgcggcgcgc
gcgggcatggtgtgcgcggtgctcgtccccgacggcaagatcgcgatgggcaagctgagc
caggcgatcgcccacggcgcgcagctgctccaggtcgacggcaacttcgacgactgcctg
gtcgcggcccgcaagctcgccgaggtccaccccgtcgagctggtgaactcggtcaacccc
gaccggatcgagggccagaagacggcggccttcgaggtcgtcgacgtcctcggcgacgcg
ccggacatccacgcgctccccgtgggcaacgccggcaacatcacggcctactggaagggc
tacctcgagtacgcgggcgtcgccacgagcgagaccggtccgggggcggccccgaccgcc
gtcgcgagccgcaccccgcgcatgtggggcttccaggccgccggcgcggcccccatcgtc
aaggggcaccccgtcgaccagccggagacgatcgcgaccgcgatccgcatcggcaacccg
gcgtcgtggcagcaggccgaggccgcgcgcgacgactccggcggcgtcatcgaggccgtg
accgacgagcagatcctcgccgcgcaccgcttgctgtcgagcgaggtcggcgtgttcgtc
gagcccgcgtccgcggccggcgtcgcgggcctgctcgaccgcgccgagcgcggcctcgtg
cccgcgggcgcgcgcgtcgtcgtcaccgtgaccgggcacgggctcaaggacccgggctgg
gcgctgcgcacggccgacggctccgaggtcgtcccgacccgcgtgagcgcggacgtcgtg
tcgatcgccgacgcgctcggtctcggctga

DBGET integrated database retrieval system