KEGG   Isoptericola variabilis: Isova_2315Help
Entry
Isova_2315        CDS       T01520                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
iva  Isoptericola variabilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isova_2315
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isova_2315
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Isova_2315
Enzymes [BR:iva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Isova_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2520849..2521958)
Genome map
AA seq 369 aa AA seqDB search
MPANQWRGVIREYAERLPEHVTREVVTLGEGGTPLVPAPALSERTGAEVYVKVEGMNPTG
SFKDRGMTTAISAAAGRGARAVVCASTGNTSASAAAYAARAGMVCAVLVPDGKIAMGKLS
QAIAHGAQLLQVDGNFDDCLVAARKLAEVHPVELVNSVNPDRIEGQKTAAFEVVDVLGDA
PDIHALPVGNAGNITAYWKGYLEYAGVATSETGPGAAPTAVASRTPRMWGFQAAGAAPIV
KGHPVDQPETIATAIRIGNPASWQQAEAARDDSGGVIEAVTDEQILAAHRLLSSEVGVFV
EPASAAGVAGLLDRAERGLVPAGARVVVTVTGHGLKDPGWALRTADGSEVVPTRVSADVV
SIADALGLG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaaccagtggcgcggcgtgatccgcgagtacgccgagcgcctgcccgagcac
gtgacgcgcgaggtggtgacgctcggcgagggcgggaccccgctcgtcccggcgccggcg
ctgtccgagcgcacgggcgccgaggtgtacgtcaaggtcgagggcatgaacccgacgggg
tccttcaaggaccgcgggatgacgacggccatctcggcggccgcgggccgcggggcgcgc
gcggtcgtgtgcgcctcgacgggtaacacctccgcgtccgccgccgcctacgcggcgcgc
gcgggcatggtgtgcgcggtgctcgtccccgacggcaagatcgcgatgggcaagctgagc
caggcgatcgcccacggcgcgcagctgctccaggtcgacggcaacttcgacgactgcctg
gtcgcggcccgcaagctcgccgaggtccaccccgtcgagctggtgaactcggtcaacccc
gaccggatcgagggccagaagacggcggccttcgaggtcgtcgacgtcctcggcgacgcg
ccggacatccacgcgctccccgtgggcaacgccggcaacatcacggcctactggaagggc
tacctcgagtacgcgggcgtcgccacgagcgagaccggtccgggggcggccccgaccgcc
gtcgcgagccgcaccccgcgcatgtggggcttccaggccgccggcgcggcccccatcgtc
aaggggcaccccgtcgaccagccggagacgatcgcgaccgcgatccgcatcggcaacccg
gcgtcgtggcagcaggccgaggccgcgcgcgacgactccggcggcgtcatcgaggccgtg
accgacgagcagatcctcgccgcgcaccgcttgctgtcgagcgaggtcggcgtgttcgtc
gagcccgcgtccgcggccggcgtcgcgggcctgctcgaccgcgccgagcgcggcctcgtg
cccgcgggcgcgcgcgtcgtcgtcaccgtgaccgggcacgggctcaaggacccgggctgg
gcgctgcgcacggccgacggctccgaggtcgtcccgacccgcgtgagcgcggacgtcgtg
tcgatcgccgacgcgctcggtctcggctga

DBGET integrated database retrieval system