KEGG   Isoptericola variabilis: Isova_2425Help
Entry
Isova_2425        CDS       T01520                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
iva  Isoptericola variabilis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Isova_2425
  Lipid metabolism
   00561 Glycerolipid metabolism
    Isova_2425
   00600 Sphingolipid metabolism
    Isova_2425
Enzymes [BR:iva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Isova_2425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2649473..2651614)
Genome map
AA seq 713 aa AA seqDB search
MQHSGVLHLRNGGTSVVLDARDVPLPAIVWWGADLGDLADAELEDLAMAARPQRVSGGID
TPTALALLPQEATGWFGTPGLAGHRPGGRGFSALLCTRDLDVAEHAGQLTGVVVRAADDA
AGLAADLEVEVTPAGLVRQRVTLTNLGDEPFELHALAPVFPLPAGADELLDTTGRHLRER
SPQRHAFTVGTHVRESRRGRPGADASLLLVAGRAGFGFERGLVHGVHVAWSGNHRLLAER
TPTAEAYLSAGELLAPGEVTLAPGASYRTPWAIGSWGDGLDALARRFHDELRARPHHPHR
PRPVTLNTWEAVYFDQSLERLTALAERAAAVGVERFVLDDGWFRGRRDDTAGLGDWYVDE
TVWPDGLGPLIDVVRGHGMEFGLWVEPEMVNPDSDLARAHPDWILRGRADLPVPARQQQV
LDLSRPDVRAYLLERLDALLTEHDIAYLKWDHNRDLLEAGSAEDGRARVHENVKALYALL
AELKRRHPGLEIESCASGGARVDLGILEHTDRVWTSDTLDPVERLQIQRYTGLLVPPELM
GAHLTTPHVHSTGRTVALDLSAGVALPGHFGIEWDLTTLDDAGLADVAQWVALHRRYRDL
LHTGVVVNADTPPDRDVRGVVARERDRAVITYTQVTTSVTYPPGRFTVPGLDPERRYAVR
VVAGSVADGPGQSPLPWTQRPVTLTGRQLGLVGLQAPVLHPGRLVVLELTAQS
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgcagcactctggcgtgctccacctgcgcaacggtggcaccagcgtcgtcctcgacgcg
cgcgacgtcccgctcccggcgatcgtctggtggggagccgacctcggcgacctcgccgac
gccgagctcgaggacctggccatggccgcccggccgcagcgtgtgtccggcggcatcgac
accccgacggcgctcgcgctcctgccgcaggaggcgaccggctggttcggcaccccgggc
ctcgccggccaccgccccggcgggcgcggcttctccgccctcctgtgcacgcgcgacctt
gacgtcgccgagcacgccgggcagctcaccggcgtcgtcgtgcgcgccgccgacgacgcg
gccggtctggccgcggacctcgaggtcgaggtcaccccggccgggctcgtgcgccagcgc
gtgacgctgaccaacctcggcgacgagccgttcgagctgcacgcgctcgcgcccgtgttc
cccctgcccgcgggcgccgacgagctgctcgacaccacgggccggcacctgcgcgagcgc
tcgccgcagcggcacgcgttcaccgtcggcacgcacgtgcgcgagagccgccgcggccgc
cccggcgccgacgcgagcctgctgctcgtcgccggtcgtgccgggttcggcttcgagcgc
ggcctcgtccacggcgtgcacgtcgcgtggagcggcaaccaccgcctgctcgccgagcgc
acgcccacggccgaggcgtacctgtccgccggcgagctgctcgcccccggcgaggtcacg
ctcgcgcccggcgcgtcgtaccggacgccgtgggcgatcggctcgtggggcgacgggctc
gacgcgctcgcgcgccgcttccacgacgagctgcgcgcccgcccgcaccacccgcaccga
ccccgcccggtcacgctcaacacgtgggaggccgtctacttcgaccagagcctcgagcgc
ctcaccgcgctcgcggagcgggccgccgccgtcggggtcgagcgcttcgtgctcgacgac
gggtggttccgcgggcgccgcgacgacaccgcgggcctgggggactggtacgtcgacgag
accgtctggcccgacggcctcggcccgttgatcgacgtcgtacgcggccacggcatggag
ttcggcctgtgggtcgagcccgagatggtcaaccccgactccgacctcgcccgggctcac
ccggactggatcctgcgcggccgcgccgacctgcccgtgccggcgcgccagcagcaggtg
ctcgacctctcgcggcccgacgtccgggcctacctgctcgagcggctcgacgcgctgctc
accgagcacgacatcgcctacctcaagtgggaccacaaccgcgacctgctcgaggccggg
tcggccgaggacggccgcgcccgcgtgcacgagaacgtcaaggcgctctacgcgctgctc
gccgagctcaagcgacgccacccgggcctggagatcgagtcgtgcgcgtcgggcggcgcg
cgcgtcgacctcggcatcctcgagcacaccgaccgcgtgtggacctcggacacgctcgac
ccggtcgagcgcctgcagatccagcggtacaccgggctgctggtgccgcccgagctcatg
ggcgcgcacctgaccacgccgcacgtccactcgacgggccgcacggtcgcgctcgacctg
tccgccggcgtcgcgctgcccggccacttcggcatcgagtgggacctgacgaccctcgac
gacgcgggcctggccgacgtcgcgcagtgggtcgcgctgcacaggcgctaccgcgacctc
ctgcacaccggcgtcgtcgtcaacgccgacaccccgcccgaccgggacgtgcgcggcgtc
gtcgcgcgcgagcgggaccgggccgtgatcacgtacacccaggtgacgacgtcggtcacg
tacccgcccggccgcttcaccgtgcccggtctggaccccgagcgccggtacgcggtgcgg
gtcgtggccggcagcgtcgccgacgggccgggacagtcgccgctgccctggacacagcgc
ccggtcacgctcacgggccgccagctcggcctcgtcgggctccaggcgcccgtgctgcat
cccggtcggctcgtcgtcctcgagctgaccgcacagtcctag

DBGET integrated database retrieval system