KEGG   Isoptericola variabilis: Isova_2524Help
Entry
Isova_2524        CDS       T01520                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
iva  Isoptericola variabilis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Isova_2524
Enzymes [BR:iva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Isova_2524
    3.5.1.-  
     Isova_2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2760402..2760986
Genome map
AA seq 194 aa AA seqDB search
MDETTRTRRALIVVDVQPTFCEGGELAVEGGNRVAEDVAAYVAVHRERYDLVVTTQDWHI
DPGEHFSDTPDFVDTWPPHGIAGTPNAELHPALADLEADVAVKKGQYAHGYSGFEGADEA
GRPLEQVLRDAGIEAVDVVGLVESHCVKRTSLDAVRAGFSTRVLTDLTIPVTPEQGEQAR
AELTAAGVELATSR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaccaccaggacgcgccgggccctcatcgtcgtcgacgtgcagccgaccttc
tgcgagggcggcgagctcgcggtcgagggcggcaaccgggtcgcggaggacgtcgcggcc
tacgtcgccgtccaccgcgagcgctacgacctcgtcgtgaccacccaggactggcacatc
gacccgggcgagcacttcagcgacacccccgacttcgtcgacacctggccgccgcacggc
atcgcgggcacgcccaacgccgagctgcaccccgcgctcgccgacctcgaggccgacgtc
gcggtcaagaagggccagtacgcgcacgggtactcgggcttcgagggcgccgacgaggcg
gggcgcccgctcgagcaggtcctgcgggacgcgggcatcgaggcggtcgacgtcgtcggg
ctcgtggagtcgcactgcgtcaagcggacgtcgctcgacgccgtgcgggcggggttctcg
acccgcgtgctgaccgacctgaccatccccgtcacgcccgagcagggcgagcaggcccgt
gccgagctcaccgccgccggcgtggagctcgccacgtcgaggtag

DBGET integrated database retrieval system