KEGG   Isoptericola variabilis: Isova_2527Help
Entry
Isova_2527        CDS       T01520                                 

Definition
(GenBank) Glycoside hydrolase, family 20, catalytic core
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
iva  Isoptericola variabilis
Pathway
iva00511  Other glycan degradation
iva00520  Amino sugar and nucleotide sugar metabolism
iva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Isova_2527
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Isova_2527
Enzymes [BR:iva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Isova_2527
Chaperones and folding catalysts [BR:iva03110]
 Intramolecular chaperones
  Others
   Isova_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AEG45235
JGI: Isova_2527
UniProt: F6FSS3
Position
complement(2763923..2765032)
Genome map
AA seq 369 aa AA seqDB search
MSLAVTDVPHRGPADPRPLPIVPWPVAVEPLDGPGPVLDAVRLDAPDPRLGALAAEQLAA
AGVRVDDAAPVGVTLRLDAAAGPPGSRSDERYTLRVSADGVVAVAPERVGLLHAVRVLRQ
LVGTDGVAPAVVVHDAPRYRWRGLMVDVVRHFFGPADLRAVVDLAGALRLRVLAHEGTEV
GISRLWFDNPATEPFLRDVIGDVARLTDGPYVHVGGDEVLTMDSDEYTRFVELACRVVRE
AGKTPVAWQEAAHARLEAGTLLQYWDPRVDAEPFVTAAAAGVRFVMSPGNRAYLDMKYTP
EHPLGLQWAGFVELRDAYDWEPTEVVPELPADAVEGVSAAVWTETLATRDEVGLPPDAAG
QLVVLALWA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcgccgtgaccgacgtcccgcaccgcgggcccgccgacccgcgcccgctgccg
atcgtcccgtggccggtcgcggtcgagccgctcgacggccccggcccggtgctcgacgcc
gtgcgcctcgacgctcccgacccgcgcctcggggcgctcgccgccgagcagctcgccgcc
gcgggcgtgcgggtcgacgacgccgcgcccgtgggcgtgaccctccggctcgacgccgcc
gccggcccgcccggctcgcgcagcgacgagcggtacaccttgcgggtctcggccgacggc
gtcgtggcggtcgcgcccgagcgcgtcggcctgctccacgccgtgcgggtgctgcgccag
ctcgtcggcaccgacggcgtcgcgcccgccgtcgtcgtccacgacgcaccgcggtaccgg
tggcgcgggctcatggtcgacgtcgtccggcacttcttcggccccgccgacctgcgtgcc
gtcgtcgacctcgccggcgcgctgcggctgcgcgttctcgcgcacgagggcaccgaggtc
ggcatctcgcggctgtggttcgacaaccccgcgacggagccgttcctgcgcgacgtgatc
ggcgacgtcgcacggctcaccgacgggccgtacgtccacgtgggcggcgacgaggtcctc
acgatggactcggacgagtacacccgcttcgtcgagctcgcgtgccgcgtggtgcgcgag
gcgggcaagacgcccgtggcgtggcaggaggccgcgcacgcgcggctcgaggccgggacg
ctgctgcagtactgggaccctcgggtcgacgccgagccgttcgtgaccgccgcggccgcg
ggcgtgcggttcgtcatgtcgccggggaaccgcgcctacctcgacatgaagtacacgccc
gagcacccgctcggcctgcagtgggcgggcttcgtcgagctgcgcgacgcgtacgactgg
gaacccaccgaggtcgtcccggagctaccggcggacgcggtcgagggcgtctccgccgcc
gtgtggaccgagacgctcgcgacgcgcgacgaggtgggccttccacccgacgccgcaggt
cagctggtcgttctagcgctgtgggcgtga

DBGET integrated database retrieval system