KEGG   Isoptericola variabilis: Isova_2527Help
Entry
Isova_2527        CDS       T01520                                 

Definition
glycoside hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
iva  Isoptericola variabilis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:iva00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:iva00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2763923..2765032)
Genome map
AA seq 369 aa AA seqDB search
MSLAVTDVPHRGPADPRPLPIVPWPVAVEPLDGPGPVLDAVRLDAPDPRLGALAAEQLAA
AGVRVDDAAPVGVTLRLDAAAGPPGSRSDERYTLRVSADGVVAVAPERVGLLHAVRVLRQ
LVGTDGVAPAVVVHDAPRYRWRGLMVDVVRHFFGPADLRAVVDLAGALRLRVLAHEGTEV
GISRLWFDNPATEPFLRDVIGDVARLTDGPYVHVGGDEVLTMDSDEYTRFVELACRVVRE
AGKTPVAWQEAAHARLEAGTLLQYWDPRVDAEPFVTAAAAGVRFVMSPGNRAYLDMKYTP
EHPLGLQWAGFVELRDAYDWEPTEVVPELPADAVEGVSAAVWTETLATRDEVGLPPDAAG
QLVVLALWA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcgccgtgaccgacgtcccgcaccgcgggcccgccgacccgcgcccgctgccg
atcgtcccgtggccggtcgcggtcgagccgctcgacggccccggcccggtgctcgacgcc
gtgcgcctcgacgctcccgacccgcgcctcggggcgctcgccgccgagcagctcgccgcc
gcgggcgtgcgggtcgacgacgccgcgcccgtgggcgtgaccctccggctcgacgccgcc
gccggcccgcccggctcgcgcagcgacgagcggtacaccttgcgggtctcggccgacggc
gtcgtggcggtcgcgcccgagcgcgtcggcctgctccacgccgtgcgggtgctgcgccag
ctcgtcggcaccgacggcgtcgcgcccgccgtcgtcgtccacgacgcaccgcggtaccgg
tggcgcgggctcatggtcgacgtcgtccggcacttcttcggccccgccgacctgcgtgcc
gtcgtcgacctcgccggcgcgctgcggctgcgcgttctcgcgcacgagggcaccgaggtc
ggcatctcgcggctgtggttcgacaaccccgcgacggagccgttcctgcgcgacgtgatc
ggcgacgtcgcacggctcaccgacgggccgtacgtccacgtgggcggcgacgaggtcctc
acgatggactcggacgagtacacccgcttcgtcgagctcgcgtgccgcgtggtgcgcgag
gcgggcaagacgcccgtggcgtggcaggaggccgcgcacgcgcggctcgaggccgggacg
ctgctgcagtactgggaccctcgggtcgacgccgagccgttcgtgaccgccgcggccgcg
ggcgtgcggttcgtcatgtcgccggggaaccgcgcctacctcgacatgaagtacacgccc
gagcacccgctcggcctgcagtgggcgggcttcgtcgagctgcgcgacgcgtacgactgg
gaacccaccgaggtcgtcccggagctaccggcggacgcggtcgagggcgtctccgccgcc
gtgtggaccgagacgctcgcgacgcgcgacgaggtgggccttccacccgacgccgcaggt
cagctggtcgttctagcgctgtgggcgtga

DBGET integrated database retrieval system