KEGG   Isoptericola variabilis: Isova_2564Help
Entry
Isova_2564        CDS       T01520                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
iva  Isoptericola variabilis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Isova_2564
   00670 One carbon pool by folate
    Isova_2564
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Isova_2564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2807859..2808392)
Genome map
AA seq 177 aa AA seqDB search
MIGLIWAQAHDDAGRPVIGAGGQIPWRIPEDFAHFRRTTTGHPVVMGRLTWESLPPRFRP
LPGRTNVVVTRQADWTAEGAVVAPSLEEGLAAAGYAPGGAQEVWVIGGAQVYAQALPLAD
TCVVTEVDLEVEGDAFAPVLGLDWTPADDGAWATSSGPGALRYRIRTYTRAPGVLRR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgggctcatctgggcgcaggcgcacgacgacgcaggccggcccgtgatcggcgcg
ggcggccagatcccctggcggatcccggaggacttcgcccacttccgtcgcacgacgacg
ggccaccccgtcgtcatgggacgcctcacctgggagtcgctgcccccgcgcttccggccg
ctgcccggccggaccaacgtcgtcgtgacccgccaggccgactggaccgccgagggcgcc
gtcgtcgcgccgtcgctcgaggaaggcctcgccgcggccgggtacgcgccgggcggcgcg
caggaggtgtgggtcatcggcggggcacaggtgtacgcgcaggcgctgccgctcgccgac
acgtgcgtcgtcaccgaggtcgacctcgaggtcgagggcgacgcgttcgcccccgtgctc
ggcctcgactggacgccggccgacgacggcgcgtgggcgacgtcgtcgggccccggcgcg
ctgcgctaccgcatccgtacctacacccgcgcgcccggcgtcctgcgccgctga

DBGET integrated database retrieval system