KEGG   Isoptericola variabilis: Isova_2638Help
Entry
Isova_2638        CDS       T01520                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
iva  Isoptericola variabilis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isova_2638
   01230 Biosynthesis of amino acids
    Isova_2638
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isova_2638
  Energy metabolism
   00680 Methane metabolism
    Isova_2638
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isova_2638
Enzymes [BR:iva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Isova_2638
Exosome [BR:iva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Isova_2638
  Exosomal proteins of melanoma cells
   Isova_2638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2883723..2884463)
Genome map
AA seq 246 aa AA seqDB search
MTYTLVLLRHGESEWNAKNLFTGWVDVPLSEKGVEEAKRGGELLKEAGVAPDVLHTSLLR
RAISTANYALDVADLHWIPVKRSWRLNERHYGALQGKDKKQIRDEYGEEQFMLWRRSYDV
PPPEIELGSEFSQDADPRYAGEPIPRTEALKQVLERALPYWDAEIVPDLKAGKTVLVAAH
GNSLRAIIKHLDGIDDQTIAGLNVPTGIPLVYELDEETLAPTVPGGRYLDPEAAKEAIAA
VANQGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaccctcgtgctgctccgccacggcgagagcgagtggaacgccaagaacctc
ttcaccggctgggtcgacgtgccgctgtcggagaagggcgtcgaggaggccaagcgcggc
ggcgagctgctcaaggaggcgggcgtcgcccccgacgtcctgcacacgtcgctcctgcgc
cgcgcgatctcgacggcgaactacgcgctcgacgtcgcggacctccactggatccccgtc
aagcgcagctggcgcctcaacgagcgccactacggcgcgctgcagggcaaggacaagaag
cagatccgtgacgagtacggcgaggagcagttcatgctctggcgccgctcgtacgacgtg
ccgccgccggagatcgagctcggctccgagttctcccaggacgccgacccgcgctacgcg
ggcgagcccatcccgcgcacggaggcgctcaagcaggtgctcgagcgggcgctgccctac
tgggacgccgagatcgtgccggacctgaaggccggcaagacggtcctcgtggccgcgcac
ggcaactcgctgcgcgcgatcatcaagcatctcgacggcatcgacgaccagacgatcgcg
ggcctcaacgtcccgaccgggatcccgctcgtctacgagctcgacgaggagacgctcgcc
cccaccgtgccgggcggccgctacctcgacccggaggcggccaaggaggccatcgccgcg
gtggccaaccagggtcgctga

DBGET integrated database retrieval system