KEGG   Isoptericola variabilis: Isova_2653Help
Entry
Isova_2653        CDS       T01520                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
iva  Isoptericola variabilis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Isova_2653
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Isova_2653
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Isova_2653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2897651..2899249)
Genome map
AA seq 532 aa AA seqDB search
MTFSGAVPGPDGQPLDQIRLTGVTATGHHGVLAHERAEGQVFRADVVLHLDTRAAARGDD
LAATVSYADVAEDVHDVLAGRPADLVETVAERIAAAALAYPAVHAVDVRVHKPQAPIAVP
FDDVEVAIRRDRVRTPVVPAEAPAGEPEQAAQVEPEAPTAPEQAEADSHEPAAERAPVTA
VPAPPAPPAPPVTGVPAFDPEPLGVVPAPPEEPEPVRDPLDVAPDEPVEVVIALGANLGE
AQATLRQAVTDIDRIAGLQVMEVSPLARTAAVGGPEQPDFLNAVLLARTTLSPREVLHAC
QRVEEQHGRVREERWGPRTLDVDIVQYGTLVATADDLELPHPRARERAFVLVPWAEVAPD
AVLHGLGGGPVAQLAATAPDRSGIRWLALDWLADPQDTVAPAPPAPPAPGTGPVPSSAPL
PERPTSGAHAVPPQTVPPQQPVPPQAVPPQQALPPQAAVPPQQAPAQPVHEPIPPAPDSP
FAPRPEQYAPATDRAYAAPSDTAPSDTAYLPPTDRAFAPPSYHPPHADDRDR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttctccggtgccgtaccgggacccgacggccagccgctcgaccagatccgcctc
acgggcgtgaccgccacgggccaccacggcgtgctcgcccacgagcgcgccgagggacag
gtgttccgcgccgacgtcgtgctgcacctcgacacgcgcgccgccgcgcggggcgacgac
ctcgccgcgaccgtgagctacgccgacgtcgccgaggacgtccacgacgtcctcgccggc
cgccccgccgacctcgtcgagacggtcgcggagcgcatcgccgcggccgcgctcgcgtac
cccgcggtgcacgccgtcgacgtgcgcgtccacaagccgcaggcgcccatcgcggtgccg
ttcgacgacgtcgaggtcgcgatccggcgcgaccgcgtccgcacgcccgtggtccccgcg
gaggcgcccgcgggggagccggagcaggccgcgcaggtcgagcccgaggcgccgaccgcg
cccgagcaggccgaggccgacagccacgagccggcggccgagcgggcccccgtcaccgcg
gtgccggcgccgcccgccccgcccgcgccgccggtgaccggcgtcccggcgttcgacccg
gagccgctcggcgtcgtgccggcgcccccggaggagcccgagccggtgcgcgacccgctc
gacgtggcgccggacgagcccgtggaggtcgtcatcgcgctcggcgcgaacctcggcgag
gcgcaggcgacgctccgccaggccgtgaccgacatcgaccgcatcgcgggcctgcaggtc
atggaggtctcgcccctcgcccgcaccgccgcggtcggcggccccgagcagccggacttc
ctcaacgccgtcctgctggcccgcaccacgctctcgccgcgcgaggtgctgcacgcgtgc
cagcgtgtcgaggagcagcacggccgggtccgcgaggagcggtggggcccgcgcacgctc
gacgtcgacatcgtgcagtacggcacgctcgtcgcgacggccgacgacctcgagctgccg
cacccgcgcgcccgcgagcgcgcgttcgtgctcgtgccgtgggccgaggtcgcgcccgac
gcggtgctccacgggctcggcggcgggccggtcgcccagctcgcggcgaccgcgccggac
cgctccgggatccgctggctcgcgctcgactggctcgccgacccgcaggacaccgtggcg
ccggcgccgcccgcgccgcccgcgccgggcacgggccccgtcccgtcgtccgcgccgctg
cccgagcgcccgacgtccggcgcccacgcggtcccccctcagaccgtgcccccgcagcag
ccggtcccgccccaggcggtgcctccgcagcaggccctgcccccgcaggcggccgtgcct
ccgcagcaggcgcccgcgcagccggtgcacgagccgatcccgccggcgccggactcgccg
ttcgcgccccgccccgagcagtacgcgccggcgaccgacagggcgtacgccgcgccgtcg
gacaccgcgccgtcggacaccgcgtacctgccgccgacggaccgggcgttcgcaccgccg
tcgtaccacccgccgcacgccgacgatcgcgaccgctga

DBGET integrated database retrieval system