KEGG   Isoptericola variabilis: Isova_2723Help
Entry
Isova_2723        CDS       T01520                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
iva  Isoptericola variabilis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:iva03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2970952..2971551)
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLAADAADVRRLVDALTEVKARVRFCEVCG
NVAESERCRICSDPRRSDEVICVVEEPKDVVAIERTREFRGRYHVLGGAINPLENVGPDD
LRISELLSRLADGTVTEVILATDPNVEGEATATYLSRLIGPMGVTVSRLASGLPVGGDLE
YADEVTLGRAFEGRRVVGS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagggcgcagtccaggacctgatcgacgagctcggccgcctccccggcgtcggg
cccaagagcgcgcagcgcatcgcgttccacctgctcgcggccgacgccgcggacgtgcgc
cggctcgtcgacgccctgaccgaggtcaaggcgcgggtccgcttctgcgaggtgtgcggg
aacgtcgcggagtcggagcgctgccggatctgcagcgacccgcggcgcagcgacgaggtg
atctgcgtcgtcgaggagcccaaggacgtcgtggcgatcgagcgcacgcgcgagttccgc
gggcgctaccacgtgctcggcggggccatcaacccgctcgagaacgtcggcccggacgac
ctgcgcatcagcgagctcctgtcccgcctggccgacggcacggtcaccgaggtcatcctc
gcgaccgacccgaacgtcgagggggaggccaccgcgacctacctgtcgcggctcatcggg
cccatgggcgtgacggtgtcccgtctggcgtccgggctgccggtgggcggagacttggag
tacgccgacgaggtgacgctcgggcgggccttcgagggccggcgcgtggtcggaagctga

DBGET integrated database retrieval system