KEGG   Isoptericola variabilis: Isova_2742Help
Entry
Isova_2742        CDS       T01520                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
iva  Isoptericola variabilis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Isova_2742
Enzymes [BR:iva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Isova_2742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2992620..2994431
Genome map
AA seq 603 aa AA seqDB search
MASFAIGPEDFLLDGRSLQIVSGALHYFRVHPDQWADRIRKARLLGLNTVETYVAWNVHS
PERGVFDTSGRRDLARFLDLVAAEGLHAIVRPGPYICAEWTGGGLPAWLFADPEVGVRRA
EPRFLEAIGEYYAALLPIVAERQVTRGGPVLMVQVENEYGAYGDDPPVERERYLRALADM
IRAQGIDVPLFTSDQANDHHLSRGSLPELLTTANFGSRATERLAILRKHQPTGPLMCMEF
WDGWFDSAGLHHHTTPPEANARDLDDLLAAGASVNLYMLHGGTNFGLTSGANDKGVYRPI
TTSYDYDAPLSEHGAPTAKYVAMREVISRHAPVPDEVPGPAPAAPTGTVRLDRRLALSDV
AGMLGTERSFDRAPTHDDVGAWDGFVLYRTRVTEDDAVLVVGEVRDRALVALDGEPVGVL
DRATHTVAVPLPRRAGELTLLVEDQGRVNYGPRIGEPKGLIGPVRTATRELTGWQVRPLR
FDDGDLLDARVADALRSAPPVRGDGADDVDGAPFAGPVLAHGTFDSTGGADHFLRLDGWT
KGLVWVNGFCLGRHRSAGPARTLYVPGPLVRDQGNEVVVLELHAAARGVVELVPEPDLGH
TEE
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgttcgccatcggccccgaggacttcctcctcgacgggcgctcgctgcagatc
gtcagcggggcgctgcactacttccgcgtgcaccccgaccagtgggccgaccgcatccgt
aaggcgcggctgctcggcctcaacaccgtcgagacgtacgtggcgtggaacgtccactcg
cccgagcgcggcgtcttcgacacctcgggacgccgggacctggcccggttcctcgacctc
gtcgcggccgagggcctccacgcgatcgtccggcccggcccgtacatctgcgcggagtgg
accggcggcggtctgccggcgtggctgttcgcggacccggaggtcggcgtgcgacgcgcg
gagccgcggttcctcgaggcgatcggcgagtactacgcggcgctgctgcccatcgtcgcg
gagcgccaggtgacacgcggcgggccggtgctcatggtccaggtcgagaacgagtacggc
gcgtacggcgacgacccgccggtcgagcgcgagcgctacctgcgtgcgctcgccgacatg
atccgggcgcagggcatcgacgtcccgctcttcacgagcgaccaggccaacgatcaccac
ctgtcgcgcgggagcctgcccgagctgctcacgacggcgaacttcggctcgcgcgcgacc
gaacggctcgcgatcctgcgcaagcaccagcccacgggcccgctcatgtgcatggagttc
tgggacggctggttcgacagcgcgggcctgcaccaccacacgacgccgcccgaggccaac
gcccgcgatctcgacgacctgctcgcggcaggcgcgtcggtcaacctctacatgctccac
ggcggcacgaacttcgggctcacctcgggcgcgaacgacaagggcgtgtaccggccgatc
accacgtcgtacgactacgacgccccgctgtccgagcacggcgccccgacggcgaagtac
gtcgcgatgcgcgaggtcatctcccgccacgcgcccgtgccggacgaggtgccgggtccc
gcgcccgccgcgcccacgggcaccgtgcggctcgaccgtcggctcgcgctgtccgacgtc
gcggggatgctcgggacggagcgctcgttcgaccgcgcgcccacgcacgacgacgtcggc
gcgtgggacggcttcgtgctctaccgcacccgggtcaccgaggacgacgccgtgctcgtg
gtcggcgaggtgcgcgaccgcgcgctcgtcgcgctcgacggcgagcccgtcggcgtgctc
gaccgggcgacccacacggtcgcggtgccgctgccgcgccgcgcgggcgagctcacgctg
ctcgtcgaggaccagggccgcgtcaactacggcccgcgcatcggcgagcccaaggggctg
atcgggccggtgcgcaccgcgacgcgcgagctcaccggctggcaggtgcggccgctgcgg
ttcgacgacggcgacctgctcgacgcgcgcgtcgcggacgcgctgcggtcggccccgccc
gtgcggggcgacggtgcggacgacgtcgacggcgctccgttcgccgggccggtgctcgcc
cacggcacgttcgacagcaccgggggcgccgaccacttcctgcggctcgacgggtggacc
aagggcctggtgtgggtcaacggcttctgcctcggccggcaccggagcgccggacccgcc
cggacgctctacgtgccggggccgctcgtgcgcgaccagggcaacgaggtcgtggtgctc
gagctgcacgccgcggcgcgcggcgtcgtcgagctcgtccccgagcccgacctgggccac
accgaggagtag

DBGET integrated database retrieval system