KEGG   Isoptericola variabilis: Isova_2743Help
Entry
Isova_2743        CDS       T01520                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
iva  Isoptericola variabilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Isova_2743
Enzymes [BR:iva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Isova_2743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2994445..2995743)
Genome map
AA seq 432 aa AA seqDB search
MHHRARSTRTAALAVAAVASVGLAGAAPALAAPPPPSDPQLWVNPDSTYHEHVENLGLTG
DASDDALYLAQFPTATWFTAGTPTSVKQEVKDVVVHAHADGEIPVLVAYNLPFRDCAQYS
AGGATSVEEYKAWIDGFAKGIGNKQAMVILEPDGLGIIPWYTTVEGVSEWCKPAEADPET
AAADRFEMLRYAVDTLGSLPGTEVYLDGTHPAWLNVGDITDRLLKAGVERATGFFLNASN
YQYTANSVAYGRWISSCIALVTQLDAGVGDCGNQYWNGGPATDWQGTGMDPYAEWASGPL
SEVPLERNTIGVDSRYAAQLGDVEPTTTFVVDTSRNGLGPWDPATSANTYPDAEAWCNPP
DRGLGLRPTLDTGEELVDGFLWIKVPGESDGQCFRGTGGPEDPERGMVAPPAGQWFVEQA
DELIALANPPAE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaccgtgcgcgcagcacccggacggcggcgctcgccgtcgccgccgtcgcgtcg
gtcgggctcgccggggcggctcccgccctcgccgccccgccgccgccgtcggacccccag
ctctgggtcaaccccgacagcacgtaccacgagcacgtcgagaacctcggcctcacgggg
gacgccagcgacgacgccctgtacctcgcgcagttcccgaccgccacgtggttcaccgcc
gggacgccgacgagcgtcaagcaggaagtcaaggacgtcgtcgtccacgcgcacgccgac
ggcgagatccccgtgctcgtggcctacaacctgccgttccgcgactgcgcgcagtactcg
gcgggcggcgcgacgagcgtcgaggagtacaaggcctggatcgacgggttcgcgaagggc
atcggcaacaagcaggcgatggtgatcctcgagccggacggcctcggcatcatcccctgg
tacacgaccgtcgagggcgtctccgagtggtgcaagcccgccgaggccgaccccgagacc
gccgcggccgaccggtttgagatgctgcgctacgcggtcgacaccctcggctcgctgccg
ggtaccgaggtctacctcgacggcacccaccccgcgtggctcaacgtcggcgacatcacc
gaccgcctgctcaaggccggcgtcgagcgcgcgaccgggttcttcctcaacgcgtcgaac
taccagtacacggccaactccgtcgcgtacggccggtggatctcgtcgtgcatcgcgctc
gtcacgcagctcgacgccggcgtgggggactgcgggaaccagtactggaacggcggcccc
gccaccgactggcagggcaccggcatggacccgtacgccgagtgggcgtccgggccgctg
tcggaggtgccgctcgagcggaacacgatcggcgtcgactcccggtacgccgcgcagctc
ggcgacgtcgagcccacgacgaccttcgtcgtcgacacgtcgcgcaacgggctcgggccg
tgggacccggcgacgtcggcgaacacgtacccggacgccgaggcgtggtgcaacccgccg
gaccgcggcctggggctgcgcccgacgctcgacacgggcgaggagctcgtcgacgggttc
ctgtggatcaaggtgcccggcgagtccgacggccagtgcttccgtggcacgggcggcccc
gaggaccccgagcgcggcatggtcgcgccgcccgcggggcagtggttcgtcgagcaggcg
gacgagctgatcgcgctggcgaacccgcccgcggagtag

DBGET integrated database retrieval system