KEGG   Isoptericola variabilis: Isova_2859Help
Entry
Isova_2859        CDS       T01520                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
iva  Isoptericola variabilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Isova_2859
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Isova_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3139728..3141206
Genome map
AA seq 492 aa AA seqDB search
MTLPERPAEEVDAVVVGGGVGGLVAAYTLVNRGLRVVVLEASDRVGGPVRGGAFAALPRV
PLDLGAESFAARGTAVASLAAELGLRVVEPAARPAWGYAAGRAFPLPAAGVLGIPSVPWA
RDVRRAVGWPGVARASLDRVLPRFVADTTDLGTLARSRLGRRVTERLVAPVAAGVHSAPL
DRLDVATVAPGLLEAFRLEASLSKAVGTLRAAAPAGSAVRGVDGGMHALVEALAGEIAAS
AEEWVDSPRVDQTGPIHTAVRLRQEVVAVERADDGAWVVRTAAGGRVEAARLVVATSALA
PLVAPWLGASGVPVPRQERGADVWLATLLLEAPELDAAPRGSGMLVAPDEGPTSRRAPGG
ERPGVRAKALTHSTAKWPWLAERVQAAAGAGVHVVRLSYGRIGEETVPPTPDEAARDASV
LLGVDLTDRVGDHLLQRWDGALPPPTPAYRADVAAFGAAVGHTPGLAVTGGWVAGTGLAA
IVAHAQAAVAGL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctccccgagcgaccggccgaggaggtcgacgccgtcgtcgtcggtggcggcgtc
ggcgggctcgtggccgcgtacacgctggtcaaccgcgggctgcgggtcgtcgtgctcgag
gcgtccgaccgcgtcggcggacccgtgcgcggcggggcgttcgcggcgctcccccgcgtg
ccgctcgacctgggcgccgagtcgttcgccgcgcgcgggacggccgtggcgagcctcgcg
gccgagctcgggctgcgcgtcgtcgagccggcggccaggccggcgtggggctacgccgcc
gggcgcgcgttcccgctgcccgcggcgggcgtgctcggcatcccgtccgtgccgtgggcg
cgcgacgtgcgccgcgcggtcggctggcccggggtcgcccgggcgtcgctcgaccgcgtg
ctgccccggttcgtcgccgacacgaccgacctcggcacgctcgcgcggtcacgcctcggc
cgccgcgtgaccgagcggctcgtcgcacccgtggccgcgggcgtgcactcggccccgctc
gaccggctcgacgtcgcgaccgtcgcgcccggcctgctcgaggcgttccggctcgaggcg
tcgctgtccaaggccgtgggcaccctgcgcgccgccgcgcccgccggctcggccgtgcgc
ggcgtcgacggcggcatgcacgcgctcgtcgaggccctcgccggggagatcgccgcgagc
gccgaggagtgggtcgactcgccgcgcgtcgaccagaccggtcccatccacaccgcggtg
cggctgcgccaggaggtcgtcgcggtcgagcgggccgacgacggcgcgtgggtcgtgcgc
acggccgccggcgggcgggtcgaggcggcgcggctcgtcgtcgcgacctcggcgctcgcg
ccgctcgtcgcgccgtggctcggcgcgtcgggcgtcccggtgccgcggcaagagcggggc
gccgacgtctggctcgcgacgctgctgctcgaggcgcccgagctcgacgccgcaccgcgc
gggtcggggatgctcgtcgcgccggacgagggcccgacgtcgcgccgcgccccgggcggg
gagcgccccggcgtgcgggccaaggcgctgacgcactcgaccgcgaagtggccgtggctc
gccgagcgcgtccaggctgccgcgggcgccggcgtgcacgtggtccggctgtcgtacggg
cgcatcggcgaggagaccgtgccccccaccccggacgaggccgcgcgggacgcctccgtg
ctgctcggcgtcgacctcaccgaccgggtcggcgaccacctgctgcagcgctgggacggc
gccctccccccgccgacccccgcctaccgggccgacgtcgcggccttcggtgccgccgtc
gggcacacgccggggctcgccgtgacgggcgggtgggtcgccgggaccgggctcgcggcg
atcgtcgcgcacgcgcaggccgcggtcgccgggctctga

DBGET integrated database retrieval system